DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and SLC25A30

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_005266378.1 Gene:SLC25A30 / 253512 HGNCID:27371 Length:293 Species:Homo sapiens


Alignment Length:300 Identity:74/300 - (24%)
Similarity:127/300 - (42%) Gaps:49/300 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEI--------LKGIHERSGILGFYNGISAS 70
            :||:.:..|..||.||||.|.:||.|.|.:.....||        |..|....|:...|:||:.:
Human    11 YGGLASITAECGTFPIDLTKTRLQIQGQTNDAKFKEIRYRGMLHALVRIGREEGLKALYSGIAPA 75

  Fly    71 WFRQLTYTTTRFALYEAGKDYVDTQKVSSKMALATFAGIVGGIVGV----PGDVVTVRLQ---ND 128
            ..||.:|.|.:...|::.|.....:.....:.:....||:.|::..    |.||:.:|:|   |.
Human    76 MLRQASYGTIKIGTYQSLKRLFIERPEDETLPINVICGILSGVISSTIANPTDVLKIRMQAQSNT 140

  Fly   129 VKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGA 193
            ::         ..:......||::||...|::|......||.::.......||..|:.|.::...
Human   141 IQ---------GGMIGNFMNIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLM 196

  Fly   194 GEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLAFYKGFIPA 258
            |:.|..||.:|...|....:.:.|:||::|..||.:             ..:.|..:.|.|.:..
Human   197 GDTVYTHFLSSFTCGLAGALASNPVDVVRTRMMNQR-------------VLRDGRCSGYTGTLDC 248

  Fly   259 LIRVS----------PNTIITF-VLYEQARMR-FGYLPPD 286
            |::::          |..:|:. .:.|:|..| |.||..|
Human   249 LLQLTVLESFSTTAKPQKLISVDAISEEADTRGFTYLSCD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 67/285 (24%)
Mito_carr 15..91 CDD:278578 28/83 (34%)
Mito_carr 93..187 CDD:278578 20/100 (20%)
Mito_carr 200..281 CDD:278578 19/92 (21%)
SLC25A30XP_005266378.1 Mito_carr 5..100 CDD:278578 28/88 (32%)
Mito_carr 102..191 CDD:278578 20/97 (21%)
Mito_carr 199..>252 CDD:278578 15/65 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.