DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Ucp1

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_036814.1 Gene:Ucp1 / 24860 RGDID:3931 Length:307 Species:Rattus norvegicus


Alignment Length:278 Identity:82/278 - (29%)
Similarity:139/278 - (50%) Gaps:21/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GVCAAIAVTGTHPIDLIKVQLQTQSQADR------KTVGEILKGIHERSGILGFYNGISASWFRQ 74
            ||.|.:|...|.|:|..||:||.|.:...      |.|...:..:.:..|:...|:|:.|...||
  Rat    21 GVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQRQ 85

  Fly    75 LTYTTTRFALYEAGKDYVDTQK-----VSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEE 134
            :::.:.|..||:..::|..:.:     :.||::.....|.|...:|.|.:||.||:|....|...
  Rat    86 ISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGI 150

  Fly   135 KRRNYKHVFDGLFRIYK----EEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGE 195
            |.|     :.|.:..|:    .|.:|:|::||.|.:.|.|::.......||.:|..|.......:
  Rat   151 KPR-----YTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNHHILAD 210

  Fly   196 GVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGG-AFLSTAKQGPLAFYKGFIPAL 259
            .||.|..::.:||....::..|:||:||.|:|:.||::..:.. |.....|:||.||:|||.|:.
  Rat   211 DVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMTMYTKEGPAAFFKGFAPSF 275

  Fly   260 IRVSPNTIITFVLYEQAR 277
            :|:....:|.||.:||.:
  Rat   276 LRLGSWNVIMFVCFEQLK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 80/274 (29%)
Mito_carr 15..91 CDD:278578 23/80 (29%)
Mito_carr 93..187 CDD:278578 27/102 (26%)
Mito_carr 200..281 CDD:278578 28/79 (35%)
Ucp1NP_036814.1 Mito_carr 10..103 CDD:278578 23/81 (28%)
Solcar 1 11..102 23/80 (29%)
PTZ00169 21..297 CDD:240302 82/278 (29%)
Mito_carr 110..205 CDD:278578 28/99 (28%)
Solcar 2 111..201 27/94 (29%)
Solcar 3 210..295 30/84 (36%)
Mito_carr 215..300 CDD:278578 28/79 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.