DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and Slc25a10

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_596909.1 Gene:Slc25a10 / 170943 RGDID:621430 Length:286 Species:Rattus norvegicus


Alignment Length:280 Identity:129/280 - (46%)
Similarity:181/280 - (64%) Gaps:9/280 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNGISASWF 72
            |..||:|||:.:..|...|||:||:||.||||.:...:..|..|: :....|.|..|||:|||..
  Rat     5 RTSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALQ-VVRTDGFLALYNGLSASLC 68

  Fly    73 RQLTYTTTRFALYEAGKDYV--DTQ---KVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLP 132
            ||:||:.||||:||..:||:  |:|   ...||:.|...:|:.||.||.|.|:|.||:|||:|||
  Rat    69 RQMTYSLTRFAIYETMRDYMTKDSQGPLPFYSKVLLGGISGLTGGFVGTPADLVNVRMQNDMKLP 133

  Fly   133 EEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATG-AGEG 196
            ..:||||.|..|||:|:.:|||:..||.|...|.||..|:|:|..:.|||.||:: ::|| ..:.
  Rat   134 LSQRRNYSHALDGLYRVAREEGLKKLFSGATMASSRGALVTVGQLSCYDQAKQLV-LSTGYLSDN 197

  Fly   197 VPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLAFYKGFIPALIR 261
            :..||.:|.|||..|..:.|||||:||..||:: ||:.|:....:.|||.||.||:||.:||.:|
  Rat   198 IFTHFLSSFIAGGCATFLCQPLDVLKTRLMNSK-GEYQGVFHCAVETAKLGPQAFFKGLVPAGVR 261

  Fly   262 VSPNTIITFVLYEQARMRFG 281
            :.|:|::||:..||.|..||
  Rat   262 LVPHTVLTFMFLEQLRKHFG 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 120/265 (45%)
Mito_carr 15..91 CDD:278578 34/75 (45%)
Mito_carr 93..187 CDD:278578 47/96 (49%)
Mito_carr 200..281 CDD:278578 38/80 (48%)
Slc25a10NP_596909.1 Mito_carr 12..92 CDD:395101 36/80 (45%)
Mito_carr 94..189 CDD:395101 45/95 (47%)
Mito_carr 197..283 CDD:395101 40/86 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352938
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51917
OrthoDB 1 1.010 - - D404074at33208
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104245
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1953
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.720

Return to query results.
Submit another query.