DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and SLC25A10

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001257882.1 Gene:SLC25A10 / 1468 HGNCID:10980 Length:406 Species:Homo sapiens


Alignment Length:175 Identity:82/175 - (46%)
Similarity:112/175 - (64%) Gaps:10/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEILKGIHERSGILGFYNGISASWF 72
            |:.||:|||:.:..|...|||:||:||.||||.:...:..|..|: :....|||..|:|:|||..
Human     6 RVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALR-VVRTDGILALYSGLSASLC 69

  Fly    73 RQLTYTTTRFALYEAGKDYVDTQKVS-------SKMALATFAGIVGGIVGVPGDVVTVRLQNDVK 130
            ||:||:.||||:||..:|.|  .|.|       .|:.|.:.:|:.||.||.|.|:|.||:|||||
Human    70 RQMTYSLTRFAIYETVRDRV--AKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVK 132

  Fly   131 LPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIG 175
            ||:.:||||.|..|||:|:.:|||:..||.|...|.||..|:|:|
Human   133 LPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 78/168 (46%)
Mito_carr 15..91 CDD:278578 34/75 (45%)
Mito_carr 93..187 CDD:278578 42/90 (47%)
Mito_carr 200..281 CDD:278578
SLC25A10NP_001257882.1 Mito_carr 13..93 CDD:278578 37/82 (45%)
Mito_carr 95..179 CDD:278578 40/83 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158943
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0759
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S759
OMA 1 1.010 - - QHG51917
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002037
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104245
Panther 1 1.100 - - O PTHR45618
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1953
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.660

Return to query results.
Submit another query.