DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and cd151

DIOPT Version :10

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:XP_031755690.1 Gene:cd151 / 100144686 XenbaseID:XB-GENE-480009 Length:266 Species:Xenopus tropicalis


Alignment Length:98 Identity:24/98 - (24%)
Similarity:34/98 - (34%) Gaps:35/98 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VQLQTQSQADRK--TVGEI--------------LKGIHERSGILGFYNGISASWFRQL----TYT 78
            |.|.|.|:.:.|  |.|.|              |.|:...:  :|.:..|..|.:..|    ||.
 Frog     2 VDLVTMSEYNEKKETCGTICLKYLLFTFNFFFWLAGLAVMA--VGIWTLIQKSDYISLLPSNTYA 64

  Fly    79 TTRFALYEAGKDYVDTQKVSSKMALATFAGIVG 111
            .|.:.|..||             |:....||:|
 Frog    65 ATAYILVIAG-------------AIVMITGILG 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 Mito_carr 15..91 CDD:395101 20/76 (26%)
Mito_carr 93..187 CDD:395101 4/19 (21%)
Mito_carr 200..281 CDD:395101
cd151XP_031755690.1 Tetraspanin 22..259 CDD:459767 16/78 (21%)
CD151_like_LEL 118..233 CDD:239408
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.