DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dic3 and ucp1

DIOPT Version :9

Sequence 1:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001107354.1 Gene:ucp1 / 100135179 XenbaseID:XB-GENE-963773 Length:309 Species:Xenopus tropicalis


Alignment Length:283 Identity:95/283 - (33%)
Similarity:139/283 - (49%) Gaps:29/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GVCAAIAVTGTHPIDLIKVQLQTQSQADRK-------------TVGEILKGIHERSGILGFYNGI 67
            |..|.||...|.|:|..||:||.|.:....             |:..|:|    ..|....|||:
 Frog    21 GTAACIADLFTFPLDTAKVRLQIQGETTGSGAANGIRYKGVFGTISTIVK----TEGPKSLYNGL 81

  Fly    68 SASWFRQLTYTTTRFALYEAGKDYVDTQKVSSKMALATFAGIVGGIVGV----PGDVVTVRLQND 128
            .|...||:::.:.|..||:..|.:....|..:.:.....||...|.:.|    |.|||.||.|..
 Frog    82 VAGLQRQMSFASIRIGLYDTVKLFYTNGKEKAGIGSRILAGCTTGALAVTVAQPTDVVKVRFQAQ 146

  Fly   129 VKLPEEKRRNYKHVFDGLFRIYKEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQML---KIA 190
            ..|...||| |....|....|.|:|||..|::||.|.|:|..::.......||.:|:.|   |:.
 Frog   147 ANLQGVKRR-YNGTMDAYKTIAKKEGVRGLWKGTFPNVTRNAIVNCTELVTYDVIKENLLHYKLM 210

  Fly   191 TGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEF-SGIGGAFLSTAKQGPLAFYKG 254
            |   :.:|.||.::..||....||..|:||:||.:||:.||:: |.:..|:....|:||.|||||
 Frog   211 T---DNLPCHFVSAFGAGFCTTVIASPVDVVKTRYMNSPPGQYKSALNCAWTMITKEGPTAFYKG 272

  Fly   255 FIPALIRVSPNTIITFVLYEQAR 277
            |:|:.:|:....::.||.|||.:
 Frog   273 FVPSFLRLGSWNVVMFVSYEQLK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 93/279 (33%)
Mito_carr 15..91 CDD:278578 26/87 (30%)
Mito_carr 93..187 CDD:278578 32/97 (33%)
Mito_carr 200..281 CDD:278578 33/79 (42%)
ucp1NP_001107354.1 Mito_carr 10..110 CDD:278578 26/92 (28%)
PTZ00169 14..299 CDD:240302 95/283 (34%)
Mito_carr 111..208 CDD:278578 32/97 (33%)
Mito_carr 211..302 CDD:278578 35/88 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D984118at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.