DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup44A and npp-20

DIOPT Version :9

Sequence 1:NP_610343.1 Gene:Nup44A / 35762 FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_500086.1 Gene:npp-20 / 176957 WormBaseID:WBGene00003806 Length:313 Species:Caenorhabditis elegans


Alignment Length:310 Identity:87/310 - (28%)
Similarity:143/310 - (46%) Gaps:37/310 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSWAHPEFG 71
            |...|:|.|||...:.||.|:|||.||:.|||::....|:....:....|||.:|:||||||::|
 Worm     8 IDTQHRDAIHDAQLNIYGSRLATCGSDRLVKIFEVRPNGQSYPMAELVGHSGPVWKVSWAHPKYG 72

  Fly    72 QVVATCSFDRTASVWEEVIGEKVSSTNTPTRRWVRRTTLVDSRTSVTDVEFAPKYLGLLLATASA 136
            .::|:.|:|:...:|.|..|           ||.:.........|.|.|.|||...||:||:|||
 Worm    73 GLLASASYDKKVIIWNEQQG-----------RWQKAYEWAAHEASTTCVAFAPHQYGLMLASASA 126

  Fly   137 DGIIRIYEAPDIMNLSQWPVQHEISNKLP------LSCLSW---NTSTYMVTQLLAAGSDEAATP 192
            ||.|.|....:..|  :|     ||:|:.      ::.:.|   :.......:|::||:|:    
 Worm   127 DGDIGILRYDNSSN--EW-----ISSKIQKCHEQGVNSVCWAPGSADPAAKKRLVSAGNDK---- 180

  Fly   193 TGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKDLYIVNLRGVTDATD 257
              .|.::|:.:.:.:.:...|:...||.|.:.|:.|......|.:.....:..:|..|.....|:
 Worm   181 --NVKIWAFDDATNEWILEKTLAGHTDFVREAAWCPVTNNGQHTIVSCGMEGNLVLFRTSNIETE 243

  Fly   258 ISKLDIQTIKFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQW 307
            ..|..:    .....|.::...::...:.|...|||..:.:||.|...||
 Worm   244 EWKAKL----LETAPCALYHSSFSPCGSFLSVAGDDNVITIWRENLQGQW 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 11..300 CDD:392136 81/297 (27%)
WD40 repeat 16..55 CDD:293791 14/38 (37%)
WD40 repeat 60..98 CDD:293791 14/37 (38%)
WD40 repeat 118..159 CDD:293791 18/40 (45%)
WD40 repeat 166..212 CDD:293791 7/48 (15%)
WD40 repeat 221..267 CDD:293791 8/45 (18%)
WD40 repeat 275..299 CDD:293791 4/23 (17%)
npp-20NP_500086.1 WD40 4..>285 CDD:225201 84/304 (28%)
WD40 12..282 CDD:295369 81/297 (27%)
WD40 repeat 61..102 CDD:293791 16/51 (31%)
WD40 repeat 108..150 CDD:293791 21/48 (44%)
WD40 repeat 155..201 CDD:293791 8/51 (16%)
WD40 repeat 212..250 CDD:293791 6/41 (15%)
WD40 repeat 257..288 CDD:293791 7/30 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375879at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.