DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup44A and Seh1l

DIOPT Version :9

Sequence 1:NP_610343.1 Gene:Nup44A / 35762 FlyBaseID:FBgn0033247 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001381923.1 Gene:Seh1l / 100911798 RGDID:6490353 Length:360 Species:Rattus norvegicus


Alignment Length:345 Identity:193/345 - (55%)
Similarity:254/345 - (73%) Gaps:16/345 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFDVEPIIADHKDVIHDVVFDYYGRRMATCSSDQTVKIWDEDGQGKWNVTSSWKAHSGSIWRVSW 65
            ||....|.|||||:||||.||::|||||||||||:||:||:...|.|:.|:|||.||||:|||:|
  Rat     1 MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSVWRVTW 65

  Fly    66 AHPEFGQVVATCSFDRTASVWEEVIGEKVSSTNTPTR---RWVRRTTLVDSRTSVTDVEFAPKYL 127
            ||||||||:|:|||||||:||||::||    :|...|   .||:||||||||||||||:||||::
  Rat    66 AHPEFGQVLASCSFDRTAAVWEEIVGE----SNDKLRGQSHWVKRTTLVDSRTSVTDVKFAPKHM 126

  Fly   128 GLLLATASADGIIRIYEAPDIMNLSQWPVQHEISNKLPLSCLSWNTSTYMV-TQLLAAGSDEAA- 190
            ||:|||.|||||:|:|||||:||||||.:|||||.||..||:|||.|:... ..::|.|||::: 
  Rat   127 GLMLATCSADGIVRVYEAPDVMNLSQWSLQHEISCKLCCSCISWNPSSSRAHPPMIAVGSDDSSP 191

  Fly   191 TPTGKVFLFAYSENSRKCVKIDTVNDITDPVTDVAFAPNAGRTFHMLAVASKDLYIVNLRGV--- 252
            ....||.:|.|:||:||..|.:|:..:||||.|:|||||.||:||:||:|:||:.|..|:.|   
  Rat   192 NSMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAIATKDVRIFTLKPVRKE 256

  Fly   253 -TDATDISKLDIQTI-KFSEHNCPVWRVCWNMLATMLISTGDDGCVRLWRMNYNRQWRCAAVLKA 315
             |.:...:|.:|..: :|..||..||||.||:..|:|.|:|||||||||:.||...|:|..:||.
  Rat   257 LTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDGCVRLWKANYMDNWKCTGILKG 321

  Fly   316 EGS--GPTYEPAPPTPTLAT 333
            .||  ..:.:....||:|::
  Rat   322 NGSPVNGSSQLGNSTPSLSS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup44ANP_610343.1 WD40 11..300 CDD:392136 176/298 (59%)
WD40 repeat 16..55 CDD:293791 25/38 (66%)
WD40 repeat 60..98 CDD:293791 26/37 (70%)
WD40 repeat 118..159 CDD:293791 30/40 (75%)
WD40 repeat 166..212 CDD:293791 19/47 (40%)
WD40 repeat 221..267 CDD:293791 22/50 (44%)
WD40 repeat 275..299 CDD:293791 16/23 (70%)
Seh1lNP_001381923.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H68701
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D375879at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.