DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and SNX21

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_219489.1 Gene:SNX21 / 90203 HGNCID:16154 Length:373 Species:Homo sapiens


Alignment Length:147 Identity:40/147 - (27%)
Similarity:66/147 - (44%) Gaps:12/147 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 QALSCEITAVQEVAG-HTEYLLR----VWRGASNKNYWTVLRRYNDFDRLDKSL----RVSGIEL 73
            |.|..|:|:...|.. .::|:|.    :..|..:.....:.|||:||:||.::|    |.....:
Human   129 QRLLFEVTSANVVKDPPSKYVLYTLAVIGPGPPDCQPAQISRRYSDFERLHRNLQRQFRGPMAAI 193

  Fly    74 PLPRKRIFGNMRPEFIAERKQALQEYINAVLMNPILASSLPAKR-FVDPE-SYSQSFHDHAVQNA 136
            ..||||:..|...|.||.|.:|.::::..:...|.|..:...:. ||.|| ..:||.....:...
Human   194 SFPRKRLRRNFTAETIARRSRAFEQFLGHLQAVPELRHAPDLQDFFVLPELRRAQSLTCTGLYRE 258

  Fly   137 MLCLRNDTTWSLGGSMG 153
            .|.|..: .|.|...:|
Human   259 ALALWAN-AWQLQAQLG 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 35/124 (28%)
PKc 237..432 CDD:270622
SNX21NP_219489.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..107
PX_SNX21 131..242 CDD:132834 30/110 (27%)
TPR repeat 244..268 CDD:276809 4/24 (17%)
TPR_12 247..312 CDD:290160 7/29 (24%)
TPR repeat 281..312 CDD:276809
TPR repeat 326..353 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.