DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and MDM1

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_013603.1 Gene:MDM1 / 854867 SGDID:S000004572 Length:1127 Species:Saccharomyces cerevisiae


Alignment Length:712 Identity:121/712 - (16%)
Similarity:223/712 - (31%) Gaps:277/712 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LPI---------DDTQALSCEITAVQEVAGHTEYLLRVWRGASNKNYWTVLRRYNDFDRLDKSLR 67
            |||         |..:|:..::|..:..:.:.:..:.|   ..||||           ::.|||.
Yeast   152 LPIFNKHFSTFCDAREAVLSDLTLERHKSANIDLQIAV---EFNKNY-----------KIHKSLS 202

  Fly    68 V------SGIELPLPRKRIFGNMRPEFIAERKQAL------QEYINAVLMNPILASSLPAKRFVD 120
            :      ..||..: ||.:.|.:...|..:...:|      .|.:...:::|::.      :|.|
Yeast   203 LKPNALQKEIEKSI-RKTVIGLLPHLFDNDELDSLLVFTLMTEVLTTCIISPLIF------KFTD 260

  Fly   121 PESY-------SQSFHD--HAVQNAMLCL----------RNDTTWSLGGSMGAIGWRLR------ 160
            |:|:       ||::.:  |.|......|          .||......|...:....|.      
Yeast   261 PDSWNLRIVSLSQNYFEEKHKVHKIRRMLSKELQDHRKVMNDVANKDVGEPSSEKLELNAEYTGK 325

  Fly   161 --KHY-----------------FKVTTKPPEKSSNKQLVKSGSQTHQSKHFAAGSSNGSGHSIDA 206
              :||                 :.:..|..:...|:.|.|...: ::.:...:.:...|..|...
Yeast   326 QFEHYLNQLDSLLDLSDIKYVAYSLALKIYQLKENEHLTKENLK-YKKRLLLSLNLIESKLSFPG 389

  Fly   207 GTLDPGSEVVAEWLEYGPDKFIDE----KEIGGIMKSLMGLQHPHIEPVLLAAHTENGCLVIRKF 267
            ..:|..|:.:|....| ||..:|.    ||:...:.|:                           
Yeast   390 SEIDTASKKLAREANY-PDLNMDNGIVLKEMASFLTSI--------------------------- 426

  Fly   268 HKHGTLKDVL-----------CMAANPK---NTFL------SKYGNP----------KGRTALSM 302
                ||||::           .:.:.|:   :|||      ..:.||          .|.:.:|.
Yeast   427 ----TLKDIVDDSEFLPFFESFLGSVPETQGSTFLEYSQTIESFKNPLEDATSEDIISGYSGIST 487

  Fly   303 KQVATYG------------KQILEAL---IFLHSKGYAYGH-------LHSGNIVIVDDCVKLLD 345
            .|:....            |.:.|.|   |.|....:...:       .....:::..:.:|.||
Yeast   488 MQLQEISSKFFHNNNLQNMKLLDEGLVKNIILFRNSFQINNDEDTFILARKSVLLLQTEAIKYLD 552

  Fly   346 IENFLLGVPAFYR-PFFMQH-SKIHAIETIDVYCFGHVLFEM-AMGYPLQESVVRQ--------- 398
             :.||   |.|.: |.|::. |..|.|.| |:|  .|.|..: .:..|.|..:::.         
Yeast   553 -DRFL---PLFKKTPSFLKMLSTSHIIST-DIY--AHFLSRIGGVNNPEQNKIIKDNVKTDFMNP 610

  Fly   399 --------ITECPEALKCLLESILSKEACK------AGLPTLEQLLG------------------ 431
                    ||:.       |::|::....|      :..|...||.|                  
Yeast   611 VRIFANPGITDA-------LDNIVNGSGSKPHKSRISSNPRYSQLFGSENDNIFKDKLFDDENDN 668

  Fly   432 ------------HRFFLQYASTESAGAAANAEKPYFKLSLNAKELLKQAAIKSENRLRDE----- 479
                        |...::..|..|..:..|..:.|                 ..|..||.     
Yeast   669 TSEISVVEDQLDHPRNMEKVSVSSGNSGLNPSQFY-----------------GSNNFRDNIASLT 716

  Fly   480 ------QKSVKNQKRIVRVQELMSSEEEKR--KSKQKAKLEHKQSK--LKQQSSIQTNNGRL 531
                  :|.::..:.::...:|.:::.:.:  |..|:..|:..:.|  ||||..:|.|...|
Yeast   717 ISIDQIEKELELLRHLILKADLTNNQMQLKILKKSQRTLLKELEMKELLKQQYMVQENGNSL 778

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 28/148 (19%)
PKc 237..432 CDD:270622 47/302 (16%)
MDM1NP_013603.1 PXA 85..276 CDD:214611 29/144 (20%)
RGS 462..567 CDD:413378 19/108 (18%)
PX_MDM1p 763..900 CDD:132786 7/16 (44%)
Nexin_C 993..1106 CDD:400794
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.