DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and AT2G15900

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_179190.3 Gene:AT2G15900 / 816086 AraportID:AT2G15900 Length:994 Species:Arabidopsis thaliana


Alignment Length:273 Identity:57/273 - (20%)
Similarity:94/273 - (34%) Gaps:85/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NKNYWTVLRRYNDFDRLDKSLR-VSGIELPLPRKRIFGNMRPE-FIAERKQALQEYINAVLMNPI 108
            ||. |.|.|||::|:||.:.|: :....|.||.||||.:...: |:..|...|.:|:..:|....
plant   542 NKT-WFVKRRYSNFERLHRQLKEIPNYNLQLPPKRIFSSSTEDAFVHRRCIQLDKYLQDLLCIAN 605

  Fly   109 LASSLPAKRFVDPESYSQSF-------------------------------------------HD 130
            :|.......|:...|.:.||                                           ||
plant   606 VAEQHEVWDFLSAASKNYSFGKSSSVMKTLAVNVDDAMDDIVRQFKGVSDGLMRKVVGSPLDEHD 670

  Fly   131 HAVQNAMLCLRNDTTWSLGGSMGAIGWRLRKHYFKVTTKPPEKSSNKQLVKSGSQTH-------- 187
            ||....:       :||:.               :::|:...:|:.:.:..|.|.|.        
plant   671 HAPTRHL-------SWSVN---------------EISTQLSRESATESMHSSISDTEDIDKLGEN 713

  Fly   188 -QSKHFAAGSSNG--SGHSIDAGTLDPGSEVVAEWLEYGPDKFIDEKEIGGIMKSLM--GLQHPH 247
             |.:......:||  |.:.:|:..:.|  .||....|  |:....|||.....||.:  .....|
plant   714 TQGEGRFDSEANGWHSDNELDSKYVPP--RVVRRLGE--PESSPSEKENDFKAKSQVRGSTDFQH 774

  Fly   248 IEPVLLAAHTENG 260
            .:|:.......:|
plant   775 ADPLTALVQNPHG 787

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 30/130 (23%)
PKc 237..432 CDD:270622 5/26 (19%)
AT2G15900NP_179190.3 PXA 105..286 CDD:366970
PX_SNX19_like_plant 513..619 CDD:132782 25/77 (32%)
Nexin_C 815..957 CDD:370015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22999
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.