DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and SNX22

DIOPT Version :10

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_079074.2 Gene:SNX22 / 79856 HGNCID:16315 Length:193 Species:Homo sapiens


Alignment Length:106 Identity:28/106 - (26%)
Similarity:43/106 - (40%) Gaps:28/106 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TVLRRYNDFDRLDKSLRVSGIELPLPRKRIFGNMRPEFIAERKQALQEYINAVL-MNPILASSL- 113
            ||.|||::|..|.|.::........|.||: .|.|...:.:|:|.|:.||..:| :|..:...| 
Human    39 TVPRRYSEFHALHKRIKKLYKVPDFPSKRL-PNWRTRGLEQRRQGLEAYIQGILYLNQEVPKELL 102

  Fly   114 ------------------PAKRFVDPESYSQ-------SFH 129
                              ..:.|:..:|.||       |||
Human   103 EFLRLRHFPTDPKASNWGTLREFLPGDSSSQQHQRPVLSFH 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 28/106 (26%)
Protein Kinases, catalytic domain 237..432 CDD:473864
WH2 622..646 CDD:425359
SNX22NP_079074.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
PX_SNX22 2..116 CDD:132790 21/77 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.