DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and SNX16

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_071416.2 Gene:SNX16 / 64089 HGNCID:14980 Length:344 Species:Homo sapiens


Alignment Length:167 Identity:46/167 - (27%)
Similarity:76/167 - (45%) Gaps:26/167 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VQEVAGHTEYLLRVWRGASNKNYWTVLRRYNDFDRLDKSLR--VSGIELPLPRKRIF-GNMRPEF 88
            ::|.|..|.|.:.|.:  :.:..|.|.|||.||.||:..|:  ..|..|.||.||.| .|...:|
Human   118 MEERAKFTVYKILVKK--TPEESWVVFRRYTDFSRLNDKLKEMFPGFRLALPPKRWFKDNYNADF 180

  Fly    89 IAERKQALQEYINAVLMNPILASSLPAKRFV---DPESYSQSFHDHAVQNAMLCLRNDTTWSLGG 150
            :.:|:..||.::..::.:..:|:.|..:.|:   ||.....|..    ::...|...:.|     
Human   181 LEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLE----ESRAFCETLEET----- 236

  Fly   151 SMGAIGWRLRKHYFKVTTKPPEKSSNKQLVKSGSQTH 187
                 .:||:|   ::..|..|..|.|:|: |..|.|
Human   237 -----NYRLQK---ELLEKQKEMESLKKLL-SEKQLH 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 33/110 (30%)
PKc 237..432 CDD:270622
SNX16NP_071416.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..66
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..107
PX_SNX16 105..214 CDD:132809 30/97 (31%)
SMC_N <231..>336 CDD:330553 12/48 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.