DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and SNX14

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001337461.1 Gene:SNX14 / 57231 HGNCID:14977 Length:967 Species:Homo sapiens


Alignment Length:159 Identity:39/159 - (24%)
Similarity:66/159 - (41%) Gaps:25/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 YWTVLRRYNDFDRLDKSLRVSGIELP---LPRKRIFGNMRPEFIAERKQALQEYINAVLMNPILA 110
            :|:|.|||.:|..|:..|.......|   ||.|||.|....||:..:::..|||:..:|.:|.|:
Human   631 HWSVYRRYLEFYVLESKLTEFHGAFPDAQLPSKRIIGPKNYEFLKSKREEFQEYLQKLLQHPELS 695

  Fly   111 SSLPAKRFVDPESYSQSFHDHAVQNAMLCLRNDTTWSLGGSMGAIGWRLRK-----------HYF 164
            :|.....|:.|......|.|..:.:.          :||..:.::..:|.|           ::.
Human   696 NSQLLADFLSPNGGETQFLDKILPDV----------NLGKIIKSVPGKLMKEKGQHLEPFIMNFI 750

  Fly   165 KVTTKPPEKSSNKQL-VKSGSQTHQSKHF 192
            .....|..|.|..:| :.|.:..:..|.|
Human   751 NSCESPKPKPSRPELTILSPTSENNKKLF 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 28/85 (33%)
PKc 237..432 CDD:270622
SNX14NP_001337461.1 PXA 151..320 CDD:308031
RGS_SNX14 361..487 CDD:188677
PX_SNX14 585..707 CDD:132787 25/75 (33%)
Nexin_C 828..932 CDD:312222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.