DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and KIF16B

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_005260807.1 Gene:KIF16B / 55614 HGNCID:15869 Length:1883 Species:Homo sapiens


Alignment Length:476 Identity:87/476 - (18%)
Similarity:171/476 - (35%) Gaps:139/476 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 IGGIMKS----LMGLQHPHIEPVLLAAHTENGCLVIRKFHKHGTLKDVLC--MAANPKNTFLSKY 291
            ||.::.|    |:|:....:...::..|.:.|...:.: ....|.:|::.  :....::......
Human   445 IGVVLDSELPHLIGIDDDLLSTGIILYHLKEGQTYVGR-DDASTEQDIVLHGLDLESEHCIFENI 508

  Fly   292 GNPKGRTALSMKQVATYGKQILEALIFLHSKGYAYGHLHSGNIVIV-----------DDCVKLLD 345
            |.......||..|.:..|.||:||.           ||:.|.::::           .:..||.:
Human   509 GGTVTLIPLSGSQCSVNGVQIVEAT-----------HLNQGAVILLGRTNMFRFNHPKEAAKLRE 562

  Fly   346 ------IENFLLGVPAFYRPFFMQHSKIHAIETIDVYCFGHVLFEMAMGYPLQ---------ESV 395
                  :.:|.|.:....:    ....:.|:          :|:...: :|::         |..
Human   563 KRKSGLLSSFSLSMTDLSK----SRENLSAV----------MLYNPGL-FPIKGPICLRLEFERQ 612

  Fly   396 VRQITECPEALKCLLESILSKE-ACKAGLPTLEQ-LLGHRFFLQYASTESAGAAANAEKPYFKLS 458
            .|:..|..|:.:.|:|.:..|: :.||.|..::| :...|...:....:......:.::..|.:.
Human   613 QREELEKLESKRKLIEEMEEKQKSDKAELERMQQEVETQRKETEIVQLQIRKQEESLKRRSFHIE 677

  Fly   459 LNAKELLKQAAIKSENRLRDEQKSVKNQKR------------IVRVQELMSSEE----------- 500
            ...|:||.:.....|.|||::|:....:||            :.|::||.::|:           
Human   678 NKLKDLLAEKEKFEEERLREQQEIELQKKRQEEETFLRVQEELQRLKELNNNEKAEKFQIFQELD 742

  Fly   501 --EKRKSKQKAKLEHKQSKLKQQSSIQTNNGRLSLVAATAAAASSSTTVV-----GELCGTDSFN 558
              :|.|.:|.||||.::.:|::|...|     :.|||...........::     ||:...:   
Human   743 QLQKEKDEQYAKLELEKKRLEEQEKEQ-----VMLVAHLEEQLREKQEMIQLLRRGEVQWVE--- 799

  Fly   559 RSDSTPEEPTTLAGIKSPPLTPGPHLGSIYQQELPSTTGAPVERQSSTPNMLSEDAEGG--DGDE 621
                  ||...|.||:...|                              .:.|...||  ||:|
Human   800 ------EEKRDLEGIRESLL------------------------------RVKEARAGGDEDGEE 828

  Fly   622 PTRSALLESICKFNRGSLRKV 642
            ..::.|  ...:|.|..|.|:
Human   829 LEKAQL--RFFEFKRRQLVKL 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781
PKc 237..432 CDD:270622 37/228 (16%)
KIF16BXP_005260807.1 KISc_KIF1A_KIF1B 2..365 CDD:276816
KISc 3..365 CDD:214526
Kinesin_assoc 364..476 CDD:292801 6/30 (20%)
FHA 478..543 CDD:278899 14/76 (18%)
TPH 610..934 CDD:290579 59/284 (21%)
GBP_C <618..818 CDD:303769 46/243 (19%)
coiled coil 808..818 CDD:293879 2/39 (5%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.