Sequence 1: | NP_610341.2 | Gene: | CG8726 / 35758 | FlyBaseID: | FBgn0033244 | Length: | 646 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005160372.1 | Gene: | snx14 / 555970 | ZFINID: | ZDB-GENE-040724-144 | Length: | 942 | Species: | Danio rerio |
Alignment Length: | 207 | Identity: | 47/207 - (22%) |
---|---|---|---|
Similarity: | 82/207 - (39%) | Gaps: | 37/207 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 WTVLRRYNDFDRLDKSL-RVSG--IELPLPRKRIFGNMRPEFIAERKQALQEYINAVLMNPILAS 111
Fly 112 SLPAKRFVDPESYSQSFHDHAVQNAMLCLRNDTTWSLGGSMGAIGWRLRKH-----------YFK 165
Fly 166 VTTKPPEKSSNKQL-VKSGSQTHQSKHFAAGSSNGSGHSIDAGTLDPGSEVVAEWLEYGPDKFID 229
Fly 230 EKEIGGIMKSLM 241 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8726 | NP_610341.2 | PX_MONaKA | 13..132 | CDD:132781 | 27/84 (32%) |
PKc | 237..432 | CDD:270622 | 1/5 (20%) | ||
snx14 | XP_005160372.1 | PXA | 130..299 | CDD:280373 | |
RGS_SNX14 | 339..465 | CDD:188677 | |||
PX_SNX14 | 563..681 | CDD:132787 | 23/74 (31%) | ||
Nexin_C | 802..905 | CDD:285792 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2101 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |