DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and snx14

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_005160372.1 Gene:snx14 / 555970 ZFINID:ZDB-GENE-040724-144 Length:942 Species:Danio rerio


Alignment Length:207 Identity:47/207 - (22%)
Similarity:82/207 - (39%) Gaps:37/207 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 WTVLRRYNDFDRLDKSL-RVSG--IELPLPRKRIFGNMRPEFIAERKQALQEYINAVLMNPILAS 111
            |:|.|:|.:|..|:..| ...|  .:..||.|||.|....||::.::...:||:..:|.:|.|::
Zfish   606 WSVYRKYVEFYVLESKLTEFHGPFQDAQLPSKRIIGPKNYEFLSSKRGEFEEYLQKLLHHPELSN 670

  Fly   112 SLPAKRFVDPESYSQSFHDHAVQNAMLCLRNDTTWSLGGSMGAIGWRLRKH-----------YFK 165
            |.....|:.|.|....|.|..:.:.          :||....::..:|.|.           :|.
Zfish   671 SQLLADFLSPFSMESQFRDKMLPDV----------NLGKIFKSVPGKLIKEKGQNLEPFIQSFFS 725

  Fly   166 VTTKPPEKSSNKQL-VKSGSQTHQSKHFAAGSSNGSGHSIDAGTLDPGSEVVAEWLEYGPDKFID 229
            ....|..|.|..:| :.|.:..:..|.|.....|.:       .|..|.|     .::..:.|::
Zfish   726 SCESPKPKPSRPELTILSPTAENNKKLFNELYRNNA-------NLPEGLE-----KKHNQNYFME 778

  Fly   230 EKEIGGIMKSLM 241
            ..|:.|....:|
Zfish   779 LMEVDGAYDYMM 790

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 27/84 (32%)
PKc 237..432 CDD:270622 1/5 (20%)
snx14XP_005160372.1 PXA 130..299 CDD:280373
RGS_SNX14 339..465 CDD:188677
PX_SNX14 563..681 CDD:132787 23/74 (31%)
Nexin_C 802..905 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.