DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and Snx13

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_006240084.1 Gene:Snx13 / 362731 RGDID:1309778 Length:1144 Species:Rattus norvegicus


Alignment Length:199 Identity:54/199 - (27%)
Similarity:85/199 - (42%) Gaps:48/199 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDDTQALSCEITAVQEVAG-----HTEYLLRVWRGASN-KNYWTVLRRYNDFDRLDKSLRV---- 68
            |.||.....:..||..|..     :..|.:.|.|.:.| :..|...|||:||.  |..:|:    
  Rat   741 ISDTVYADYDPYAVAGVCNDHGKTYALYAITVHRRSLNTEEMWKTYRRYSDFH--DFHMRITEQF 803

  Fly    69 ---SGIELPLPRKRIFGNMRPEFIAERKQALQEYINAVLMNPILASSLPAKR-----FVDPESYS 125
               |.| |.||.|:.|.||..:|:.:||:.|..|:. :|:.|.:..:.||..     |::.::||
  Rat   804 ENLSSI-LKLPGKKTFNNMDRDFLEKRKKDLNAYLQ-LLLTPEMLKASPALAHCVYDFLENKAYS 866

  Fly   126 QSFHDHA----------------VQNAMLCLRND-----TTWS--LGGSMGAIGWRLRKHYFKVT 167
            :...|.|                |.||:..|.:.     |..|  :|.....:|..:::.:||| 
  Rat   867 KGKGDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGVTKMSDNVGRMSERLGQDIKQSFFKV- 930

  Fly   168 TKPP 171
              ||
  Rat   931 --PP 932

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 40/135 (30%)
PKc 237..432 CDD:270622
Snx13XP_006240084.1 PXA 273..460 CDD:295366
RGS_SNX13 553..687 CDD:188674
PX_SNX13 733..863 CDD:132783 37/125 (30%)
Nexin_C 979..1087 CDD:285792
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.