DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and CG5439

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_609607.1 Gene:CG5439 / 34710 FlyBaseID:FBgn0032476 Length:520 Species:Drosophila melanogaster


Alignment Length:97 Identity:35/97 - (36%)
Similarity:49/97 - (50%) Gaps:14/97 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EITAVQEVAGHTEYLLRVWRGASNKNYWTVLRRYNDFDRLDKSLR-----VSGIELPLPRKRIFG 82
            ::...|....|..|.:.:.. .....:||..|||::|.:|.|||.     ||.:|.| |:|. ||
  Fly   412 KLAKTQRSGSHYTYEVHITM-RQRLEHWTFFRRYSEFYKLHKSLLKTHPVVSAVEFP-PKKH-FG 473

  Fly    83 NMRPEFIAERKQALQEYINAVLMNPILASSLP 114
            ||...|:.||:|.||.|    |:|  |..:||
  Fly   474 NMNLVFVEERRQQLQIY----LLN--LVETLP 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 35/97 (36%)
PKc 237..432 CDD:270622
CG5439NP_609607.1 RUN 64..206 CDD:280855
PX_RUN 404..520 CDD:132810 35/97 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.