DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and SNX15

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_037438.2 Gene:SNX15 / 29907 HGNCID:14978 Length:342 Species:Homo sapiens


Alignment Length:116 Identity:27/116 - (23%)
Similarity:45/116 - (38%) Gaps:18/116 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GHTEYLLRVW----RGASNKNYWTVLRRYNDFDRLDKSLRVSGIEL--------PLPRKRIFGNM 84
            |:|||.:...    :...:.....|.:||:||.:|...|..:...|        ..||.::||..
Human    24 GYTEYKVTAQFISKKDPEDVKEVVVWKRYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQVFGRF 88

  Fly    85 RPEFIAERKQALQEYINAVLMNPILASSLPAKRF------VDPESYSQSFH 129
            ....|.||::..::.:...:..|.|.:|...|.|      ..|...|:..|
Human    89 EASVIEERRKGAEDLLRFTVHIPALNNSPQLKEFFRGGEVTRPLEVSRDLH 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 27/116 (23%)
PKc 237..432 CDD:270622
SNX15NP_037438.2 PX_domain 9..126 CDD:321991 24/101 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..267
MIT_SNX15 267..341 CDD:239140
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.