DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and Snx15

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001019923.1 Gene:Snx15 / 293691 RGDID:1305803 Length:338 Species:Rattus norvegicus


Alignment Length:103 Identity:26/103 - (25%)
Similarity:43/103 - (41%) Gaps:20/103 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 GHTEYLLRVWRGASNKN--------YWTVLRRYNDFDRLDKSLRVSGIEL--------PLPRKRI 80
            |:|||.:.. :..|.|:        .|   :||:||.:|...|..:...|        ..||.::
  Rat    25 GYTEYKVTA-QFISKKDPEDIKEVVVW---KRYSDFRKLHGDLAYTHRNLFRRLEEFPAFPRAQV 85

  Fly    81 FGNMRPEFIAERKQALQEYINAVLMNPILASSLPAKRF 118
            ||......|.||::..::.:...:..|.|.:|...|.|
  Rat    86 FGRFEASVIEERRKGAEDLLRFTVPIPALNNSPQLKEF 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 26/103 (25%)
PKc 237..432 CDD:270622
Snx15NP_001019923.1 PX_domain 10..127 CDD:295365 26/103 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 134..155
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 240..270
MIT_SNX15 268..338 CDD:239140
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.