DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and SNX13

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001337791.1 Gene:SNX13 / 23161 HGNCID:21335 Length:968 Species:Homo sapiens


Alignment Length:203 Identity:51/203 - (25%)
Similarity:86/203 - (42%) Gaps:39/203 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 IDDTQALSCEITAVQEVA---GHTEYLLRVW---RGASNKNYWTVLRRYNDFD----RLDKSLRV 68
            |.||.....:..||..|.   |.|..|..:.   |..:::..|...|||:||.    |:.:....
Human   565 ISDTVYADYDPYAVAGVCNDHGKTYALYAITVHRRNLNSEEMWKTYRRYSDFHDFHMRITEQFES 629

  Fly    69 SGIELPLPRKRIFGNMRPEFIAERKQALQEYINAVLMNPILASSLPAKR-----FVDPESYSQSF 128
            ....|.||.|:.|.||..:|:.:||:.|..|:. :|:.|.:..:.||..     |::.::||:..
Human   630 LSSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQ-LLLAPEMMKASPALAHYVYDFLENKAYSKGK 693

  Fly   129 HDHA----------------VQNAMLCLRN---DTTWSLGGSMGAIGWRL----RKHYFKVTTKP 170
            .|.|                |.||:..|.:   :....:..:||.:..||    ::.:|||....
Human   694 GDFARKMDTFVNPLRNSMRNVSNAVKSLPDSLAEGMTKMSDNMGKMSERLGQDIKQSFFKVPPLI 758

  Fly   171 PEKSSNKQ 178
            |:..|:.:
Human   759 PKTDSDPE 766

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 37/132 (28%)
PKc 237..432 CDD:270622
SNX13NP_001337791.1 PXA 97..284 CDD:214611
RGS_SNX13 377..511 CDD:188674
PX_SNX13 557..687 CDD:132783 34/122 (28%)
Nexin_C 803..911 CDD:312222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.