DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and Sgk3

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001362972.1 Gene:Sgk3 / 171498 RGDID:620242 Length:496 Species:Rattus norvegicus


Alignment Length:488 Identity:107/488 - (21%)
Similarity:168/488 - (34%) Gaps:139/488 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SCEITAVQEVAGHTE-------YLLRVWRGASNKNYWTVLRRYNDFDRLDKSLR--VSGIELPLP 76
            ||...::.....|.|       |.:.|..|.|.   |.|.|||.:||:|..||:  ...:.|.:|
  Rat    12 SCPSVSIPSSDEHREKKKRFTVYKVLVSVGRSE---WFVFRRYAEFDKLYNSLKKQFPAMALKIP 73

  Fly    77 RKRIFG-NMRPEFIAERKQALQEYINAVLMNPILASSLPAKRFV---DPESYSQSFHDHAVQNAM 137
            .||||| |..|:||.:|:..|.|:|..::..|.|.:....:.|:   .|...|....|...::  
  Rat    74 AKRIFGDNFDPDFIKQRRAGLNEFIQNLVRYPELYNHPDVRAFLQMDSPRHQSDPSEDEDERS-- 136

  Fly   138 LCLRNDTTWSLGGSMGAIGWRLRKHYFKVTTKPPEKSSNKQLVKSGSQTHQSKHFAAGSSNGSGH 202
                                         |.||...|.|..|..:|:...:...|......|.|.
  Rat   137 -----------------------------TPKPHSTSRNINLGPTGNPHAKPSDFDFLKVIGKGS 172

  Fly   203 SIDAGTLDPGSEVVAEWLEYGPDKF-----------IDEKEIGGIMKS----LMGLQHPHIEPVL 252
            .        |..::|:....|  ||           ::.||...||..    |..::||.:..:.
  Rat   173 F--------GKVLLAKRKLDG--KFYAVKVLQKKIVLNRKEQKHIMAERNVLLKNVKHPFLVGLH 227

  Fly   253 LAAHTENGCLVIRKFHKHGTLKDVLCMAANPKNTFL-----SKYGNPKGRTALSMKQVATYGKQI 312
            .:..|......:..|...|.|             |.     ..:..|:.|         .|..:|
  Rat   228 YSFQTTEKLYFVLDFVNGGEL-------------FFHLQRERSFPEPRAR---------FYAAEI 270

  Fly   313 LEALIFLHSKGYAYGHL--------HSGNIVIVD-----DCVKLLDIENFLLGVPAFYRPFFMQH 364
            ..||.:|||....|..|        ..|::|:.|     :.:.:.|......|.|.:..|..::.
  Rat   271 ASALGYLHSIKIVYRDLKPENILLDSMGHVVLTDFGLCKEGIAISDTTTTFCGTPEYLAPEVIRK 335

  Fly   365 SKIHAIETIDVYCFGHVLFEMAMGYP---------LQESVVRQITECPEALK--------CLLES 412
            ....  .|:|.:|.|.||:||..|.|         :.::::.:    |..|:        .:||.
  Rat   336 QPYD--NTVDWWCLGAVLYEMLYGLPPFYCRDVAEMYDNILHK----PLNLRPGVSLTAWSILEE 394

  Fly   413 ILSKEACKAGLPTLEQLL---GHRFFLQYASTE 442
            :|.|.. :..|...|..|   .|.||...:.|:
  Rat   395 LLEKNR-QNRLGAKEDFLEIQNHPFFESLSWTD 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 39/123 (32%)
PKc 237..432 CDD:270622 46/236 (19%)
Sgk3NP_001362972.1 PX_CISK 12..120 CDD:132780 36/110 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 121..157 10/66 (15%)
STKc_SGK3 165..490 CDD:270755 60/301 (20%)
Nuclear localization signal. /evidence=ECO:0000250 195..205 2/9 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.