DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and Kif16b

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_036014693.1 Gene:Kif16b / 16558 MGIID:1098240 Length:1908 Species:Mus musculus


Alignment Length:420 Identity:79/420 - (18%)
Similarity:155/420 - (36%) Gaps:106/420 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 KQLVKSGSQTHQSKHFAAGSSNGSGHSIDAGTLDPGSEVVAEWLEYGPDKFIDE------KE-IG 234
            |.|:..|:|........|.|.....|..:|...:...|...:|.|  ....:.|      || ||
Mouse   418 KTLLAQGNQIALLDSPTALSMEEKLHQNEARVQELTKEWTNKWNE--TQNILKEQTLALRKEGIG 480

  Fly   235 GIMKS----LMGLQHPHIEPVLLAAHTENGCLVIRKFHKHGTLKDVL----------CMAANPKN 285
            .::.|    |:|:....:...::..|.:.|...:.: ....|.:|::          |:..|...
Mouse   481 VVLDSELPHLIGIDDDLLSTGIILYHLKEGQTYVGR-EDASTEQDIVLHGLDLESEHCVFENAGG 544

  Fly   286 TFLSKYGNPKGRTALSMK--QVATYGKQILEALIFLHSKGYAYGHLHSGNIVIV----------- 337
            |.          |.:.::  |.:..|.||::|.           .|:.|.::::           
Mouse   545 TV----------TLIPLRGSQCSVNGVQIVDAT-----------QLNQGAVILLGRTNMFRFNHP 588

  Fly   338 DDCVKLLD------IENFLLGVPAFYRPFFMQHSKIHAIETID-VYCFGHVLFEMAMGYPLQESV 395
            .:..||.:      :.:|.|.:....:          :.|.:. |..:...||.:.....|:...
Mouse   589 KEAAKLREKRKSGLLSSFSLSMTDLSK----------SCENLSAVMLYNPGLFPIKGPICLRLEF 643

  Fly   396 VRQITECPEALKC---LLESILSKE-ACKAGLPTLEQ-LLGHRFFLQYASTESAGAAANAEKPYF 455
            .||..|..|.|:.   |:|.:..|: :.||.|..::| :...|...:....:......:.::..|
Mouse   644 ERQQREELEKLESKRKLIEEMEEKQKSDKAELERMQQEVETRRKETEIVQRQIRKQEESLKRRSF 708

  Fly   456 KLSLNAKELLKQAAIKSENRLRDEQKSVKNQKR------------IVRVQELMSSEEEKR----- 503
            .:....|:||.:.....|.||| ||:.::.|:|            :.::|||.|.|:.::     
Mouse   709 HIENKLKDLLAEKERFEEERLR-EQQGLEQQRRQEEESLFRIREELRKLQELNSHEQAEKVQIFQ 772

  Fly   504 --------KSKQKAKLEHKQSKLKQQSSIQ 525
                    ::.|.|||..::.:|:::...|
Mouse   773 ELDRLHQEQNAQSAKLRLEKRRLEEEEKEQ 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781
PKc 237..432 CDD:270622 39/233 (17%)
Kif16bXP_036014693.1 KISc_KIF1A_KIF1B 51..399 CDD:276816
Kinesin_assoc 398..510 CDD:406567 20/93 (22%)
FHA 512..577 CDD:395400 13/86 (15%)
SbcC <644..1081 CDD:223496 36/160 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.