DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8726 and Snx21

DIOPT Version :9

Sequence 1:NP_610341.2 Gene:CG8726 / 35758 FlyBaseID:FBgn0033244 Length:646 Species:Drosophila melanogaster
Sequence 2:XP_030102304.1 Gene:Snx21 / 101113 MGIID:1917729 Length:372 Species:Mus musculus


Alignment Length:217 Identity:52/217 - (23%)
Similarity:78/217 - (35%) Gaps:67/217 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VLRRYNDFDRLDKSLR------VSGIELPLPRKRIFGNMRPEFIAERKQALQEYINAVLMNPILA 110
            :.|||:||:||.::|:      :|.|.  .||||:..|...|.||.|.:|.::::..:...|.|.
Mouse   167 ISRRYSDFERLHRNLQRQFRGPMSAIS--FPRKRLRRNFTAETIARRSRAFEQFLGHLQAVPELR 229

  Fly   111 SSLPAKR-FVDPE-SYSQSFHDHAVQNAMLCLRNDTTWSLGGSMGAIGWRLRKHYFKVTTKPPEK 173
            .:...:. ||.|| ..:||.....:....|.|..: .|.|...:|.                |..
Mouse   230 QAPDLQDFFVLPELRRAQSLTCTGLYREALALWAN-AWQLQTQLGT----------------PSG 277

  Fly   174 SSNKQLVKSG-SQTHQSKHFAAGSSNGSGHSIDAGTLDPGSEVVAEWLEYGPDKFIDEKEIGGIM 237
            .....|..:| :..||...                  |||..           :...||.:    
Mouse   278 PDRPLLTLAGLAVCHQELE------------------DPGEA-----------RACSEKAL---- 309

  Fly   238 KSLMGLQHPHIEPVL---LAAH 256
             .|:|.:.||  |.|   |.||
Mouse   310 -QLLGDKRPH--PFLAPFLEAH 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8726NP_610341.2 PX_MONaKA 13..132 CDD:132781 28/87 (32%)
PKc 237..432 CDD:270622 9/23 (39%)
Snx21XP_030102304.1 PX_domain 121..241 CDD:383026 24/75 (32%)
TPR_12 243..312 CDD:315987 17/119 (14%)
TPR repeat 243..267 CDD:276809 4/24 (17%)
TPR repeat 280..311 CDD:276809 9/64 (14%)
TPR repeat 325..352 CDD:276809 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2101
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.