DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and DYNLT2

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_777570.1 Gene:DYNLT2 / 6991 HGNCID:11695 Length:198 Species:Homo sapiens


Alignment Length:186 Identity:42/186 - (22%)
Similarity:77/186 - (41%) Gaps:18/186 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EERRSKDVVPETAAKEAETGKGKKEKKEK--SAEGTKPRPASSQRGSLTKSHMGVSLPMGAPAAK 68
            :|||     |....|||.|...::..:|.  :.:..:| |.......:.|..         .:|.
Human    29 KERR-----PSMFEKEAYTQILRERLRESIHNVQYVEP-PFDDSIADIGKEW---------KSAL 78

  Fly    69 PTMRFMPTYRLESKNPLNKERVENIIKAVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNY 133
            ..::|..:||:|.........||..::.::.....| ..:..|...|::.::::.|...:|...|
Human    79 AKLKFANSYRMEPLKKFQAHSVETKVQQILTESLKD-VKYDDKVFSHLSLELADRILLAVKEFGY 142

  Fly   134 DRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD 189
            .||::|:.|...:...|.:.....::||...|.:|....|..||.|:...|.|||:
Human   143 HRYKFIIKVLFIQKTGQAINIASRWIWDIAWDSWVAAKHEAESYVALVLVFALYYE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 22/99 (22%)
DYNLT2NP_777570.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 3/9 (33%)
VirB10_like <11..>72 CDD:330184 11/48 (23%)
Tctex-1 100..196 CDD:308957 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6688
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_111885
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.620

Return to query results.
Submit another query.