DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and Dynlt2b

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_079605.1 Gene:Dynlt2b / 66061 MGIID:1913311 Length:144 Species:Mus musculus


Alignment Length:147 Identity:38/147 - (25%)
Similarity:68/147 - (46%) Gaps:7/147 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 ASSQRG-SLTKSHMGVS-LPMGAPAAKPTMRFMPTYRLESKNPLNKERVENIIKAVMNRHYNDEY 106
            |.|.|| ||:....|:| :...:...:.|....|.::...:..:.|:.:..::|..:   .:.||
Mouse     2 AVSFRGLSLSAHSEGLSEVDKNSGEPENTYILRPIFQQRFRPSVVKDCIHTVLKEEL---ASAEY 63

  Fly   107 MFHPKHSLHMAAQVSEEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYS 171
              .|.....:..::||.||:::|...||||:.:|.|.:||...:|::......|||:.|.:....
Mouse    64 --SPDEMPQLTKRLSEMIKDKLKELGYDRYKMVVQVVIGEQRGEGVFMAARCFWDADTDNYTHDV 126

  Fly   172 VERPSYFAVCTTFYLYY 188
            ....|.|.|...|..:|
Mouse   127 FMNDSLFCVVAAFGCFY 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 27/99 (27%)
Dynlt2bNP_079605.1 Tctex-1 46..142 CDD:281624 27/100 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838660
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.