DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and dynlt2b

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_685487.3 Gene:dynlt2b / 553323 ZFINID:ZDB-GENE-081104-219 Length:150 Species:Danio rerio


Alignment Length:164 Identity:39/164 - (23%)
Similarity:71/164 - (43%) Gaps:24/164 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 GKGKKEKKEKSAEGTKPRPASSQRGSLTKSHMGVSLPMGAPAAKPTMRFMPTYRLESKNPLNKER 89
            ||..|.|.|.:.         :|:..::....|.:          |....|.|:.:.|..:.||.
Zfish    10 GKAVKRKCETTI---------AQKRDISLMDTGAN----------TYLIRPNYKDKFKAGVAKEC 55

  Fly    90 VENIIKAVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYS 154
            :..|::..:   |..:|  .|:....::..:::.||:::|...:|||::||.|.:||...:|:..
Zfish    56 IGEILREQL---YGVQY--DPEEVPTLSRSLADSIKHKLKDMAFDRYKFIVQVVIGEQRGEGVKM 115

  Fly   155 MVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYY 188
            .....|||:.|.:........|.|.|...|.:||
Zfish   116 AARCFWDADTDNYAQEIYMNDSLFCVAAAFAVYY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 26/99 (26%)
dynlt2bXP_685487.3 DLC-like_TCTEX1D2 46..149 CDD:412007 27/107 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582465
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21255
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.