DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and dynlt5

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001004623.1 Gene:dynlt5 / 447884 ZFINID:ZDB-GENE-040912-49 Length:173 Species:Danio rerio


Alignment Length:122 Identity:31/122 - (25%)
Similarity:61/122 - (50%) Gaps:1/122 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KPTMRFMPTYRLESKNPLNKERVENIIKAVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDN 132
            :||::...|||:..........|::::|.|:..:..:| .:..:....|...::|.:|.|:|...
Zfish    53 RPTVQMENTYRITPSRRFPVLTVKDLLKDVLTSYLQEE-KYETELCRQMTKTITEVVKARVKDLM 116

  Fly   133 YDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD 189
            ..||:.||::::|:...|.:......|||...|.|.::..:..|.||..|.|.:|::
Zfish   117 IPRYKIIVVISIGQIKDQNIRMGSRCLWDDNHDNFSSHIFKNNSLFAAATVFGVYFE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 25/99 (25%)
dynlt5NP_001004623.1 Tctex-1 75..171 CDD:281624 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48300
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.