DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and CG5359

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001163579.1 Gene:CG5359 / 41222 FlyBaseID:FBgn0037773 Length:173 Species:Drosophila melanogaster


Alignment Length:184 Identity:42/184 - (22%)
Similarity:75/184 - (40%) Gaps:23/184 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ERRSKDVVPETAAKEAETGKGKKEKKEKSAEGTKPRPASSQRGSLTKSHMGVSLPMGAPAAKPTM 71
            |..:|.|...|....|:      .|.||||.|:....::....:..||.        .|..:||.
  Fly     8 EETTKSVQTLTVPNPAD------RKSEKSASGSLHSGSADGLENQEKSE--------KPGDQPTA 58

  Fly    72 RFM-PTYRLESKNPLNKERVENII-KAVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDN-Y 133
            ..| |.:......|..|..:.|:: :.:.::.|:.:.      :....:::::|:..:|...: .
  Fly    59 YSMRPAFGEMFPLPTIKSIMNNVMAEKLKDKTYDKDV------AKKWTSEIADEVNQQIASSSLV 117

  Fly   134 DRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLY 187
            .||:::|.|.:|:.|..|........||.:.|..|:......|.|.|||.|..|
  Fly   118 KRYKHVVQVMLGQELGAGATYNSRCCWDCDCDTSVSEVFSNTSLFCVCTVFGTY 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 22/101 (22%)
CG5359NP_001163579.1 Tctex-1 74..171 CDD:281624 22/102 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440458
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.