DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and Dynlt5

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_006238521.1 Gene:Dynlt5 / 362553 RGDID:1311932 Length:178 Species:Rattus norvegicus


Alignment Length:168 Identity:41/168 - (24%)
Similarity:74/168 - (44%) Gaps:22/168 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PASSQRGSL----------TKSHMGV--SLPMGAPAAKPT---------MRFMPTYRLESKNPLN 86
            ||..:|||:          .:.|..|  |:...:.:.:|:         :|...||:|....|..
  Rat    12 PAMKKRGSMCSPNNHEFRQKEGHWRVKNSVCTVSHSDEPSHHDESSGLQVRMENTYQLGPTKPFP 76

  Fly    87 KERVENIIKAVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNYDRYRYIVLVTVGEFLMQG 151
            ...|..|::.|:.. |..|..:.|:....|...:||.||.::|.....||:.||.|.:|:...|.
  Rat    77 VATVNRILEDVLTT-YLQEAKYDPEFCRQMTKTISEVIKTQVKQLMIPRYKLIVTVYIGQRDDQS 140

  Fly   152 LYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYYD 189
            :......||:.:.|...:|:.:.|:.||:...:.:|::
  Rat   141 IVIGSRCLWNPKSDTVSSYTFKNPTLFALANVYAVYFE 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 26/99 (26%)
Dynlt5XP_006238521.1 Tctex-1 80..176 CDD:281624 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48300
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.