DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and CG12836

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001286153.2 Gene:CG12836 / 35630 FlyBaseID:FBgn0033140 Length:174 Species:Drosophila melanogaster


Alignment Length:198 Identity:47/198 - (23%)
Similarity:79/198 - (39%) Gaps:57/198 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDSPEERRSKDVVPETAAKEAETGKGKKEKKEKSAEGTKPRPASSQRGSLTKSHMGVSLPMGAP 65
            :.:|...||.....||..|...|.|:.:|||                                  
  Fly    25 LSESMLSRRRAAQNPEGEATGGEAGEPRKEK---------------------------------- 55

  Fly    66 AAKPTMRFMPTYRLESKNPLNKERVENIIKAVM---------NRHYNDEYMFHPKHSLHMAAQVS 121
             .|...:|..|       ..|.||.:.||:..:         :|:| |.:     .:|.:|..::
  Fly    56 -PKNDWKFFHT-------NFNMERAQKIIEDCIEERLLWDRFSRNY-DSW-----RALQLAEGLA 106

  Fly   122 EEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYL 186
            .||::|:|..|:.|:|.:.|:::.|...||:|..:..|.|.::|.|.....|||:||.:...:.:
  Fly   107 AEIRDRVKKLNHRRHRIVCLLSIVEKQNQGVYQRMCHLMDEKRDNFTQLVFERPTYFMIVVLYLV 171

  Fly   187 YYD 189
            |.|
  Fly   172 YKD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 31/108 (29%)
CG12836NP_001286153.2 Tctex-1 71..172 CDD:281624 29/106 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43640
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21255
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.