Sequence 1: | NP_001286175.1 | Gene: | CG14763 / 35757 | FlyBaseID: | FBgn0033243 | Length: | 189 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001013654.1 | Gene: | DYNLT4 / 343521 | HGNCID: | 32315 | Length: | 221 | Species: | Homo sapiens |
Alignment Length: | 216 | Identity: | 48/216 - (22%) |
---|---|---|---|
Similarity: | 84/216 - (38%) | Gaps: | 60/216 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 GKKEKKEKSAEGTKP---------------RPA------SSQRGSL------------------- 51
Fly 52 ---TKSHMGVSLPMGA-------PAAKPTMRFMPTYRLESKNPLNKE-----RVENIIKAVMNRH 101
Fly 102 YNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDG 166
Fly 167 FVTYSVERPSYFAVCTTFYLY 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14763 | NP_001286175.1 | DLC-like_SF | 86..186 | CDD:425407 | 23/104 (22%) |
DYNLT4 | NP_001013654.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..52 | 9/42 (21%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 65..87 | 1/21 (5%) | |||
DLC-like_SF | 108..221 | CDD:425407 | 29/116 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4108 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R11317 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |