DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and Dynlt4

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_778195.1 Gene:Dynlt4 / 242646 MGIID:3045358 Length:219 Species:Mus musculus


Alignment Length:222 Identity:55/222 - (24%)
Similarity:88/222 - (39%) Gaps:46/222 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PEERRSKDVVPETAAKEAETGKGKKEKKEKSAEGTK---PRPASSQRGSLTKSH----------- 55
            |..|:.::...:.|.|   ...||......|.:.|:   |.|| |:||||...|           
Mouse     7 PSRRQEEETTKDLALK---LPPGKPGGHLPSIDETRPIGPGPA-SRRGSLPGLHPSFSRRNSLAG 67

  Fly    56 -----------MGVSLPMGA-------PAAKPTMRFMPTYRLESKNPLNKER-----VENIIKAV 97
                       :|...|:|:       |...| .|..|:||||   |...|.     .:..::|.
Mouse    68 PLVGPGGRRPSLGPVPPLGSRVSFSGLPLMLP-RRMAPSYRLE---PAPGEHWEAAGAQRALEAA 128

  Fly    98 MNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDA 162
            :....|. ..:....:..:...:.|:|..|::..|..||:.:..|.:|....||::.:...||||
Mouse   129 LTTQLNG-VCYCGSEAGKLVQALCEQIHTRVRELNLPRYKLVCNVVLGPREGQGVHVVSRALWDA 192

  Fly   163 EKDGFVTYSVERPSYFAVCTTFYLYYD 189
            ..||..:.:...||.|||.|...:|::
Mouse   193 VHDGLASATFTNPSLFAVATVHAVYWE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 25/104 (24%)
Dynlt4NP_778195.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..84 18/80 (23%)
Tctex-1 121..217 CDD:367593 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43640
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R11317
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.