DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and Dynlt2a1

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_036016363.1 Gene:Dynlt2a1 / 21647 MGIID:98642 Length:239 Species:Mus musculus


Alignment Length:68 Identity:20/68 - (29%)
Similarity:29/68 - (42%) Gaps:8/68 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GDSPEERRSKDVVPETAAKEAETGKGKKEKKEKSAEGTKPRPASSQRGSLTKSHMGVSLPMGAPA 66
            |..|..|.::   ...|||..|||....:...::..|..| .|..||..|.:|    ::|.|..:
Mouse    24 GAGPGRRAAR---ATAAAKTTETGGAGADDSGRARGGAVP-AAVRQRPGLPRS----AVPKGERS 80

  Fly    67 AKP 69
            |.|
Mouse    81 ALP 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407
Dynlt2a1XP_036016363.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_111885
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.670

Return to query results.
Submit another query.