powered by:
Protein Alignment CG14763 and Dynlt2a1
DIOPT Version :9
Sequence 1: | NP_001286175.1 |
Gene: | CG14763 / 35757 |
FlyBaseID: | FBgn0033243 |
Length: | 189 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_036016363.1 |
Gene: | Dynlt2a1 / 21647 |
MGIID: | 98642 |
Length: | 239 |
Species: | Mus musculus |
Alignment Length: | 68 |
Identity: | 20/68 - (29%) |
Similarity: | 29/68 - (42%) |
Gaps: | 8/68 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GDSPEERRSKDVVPETAAKEAETGKGKKEKKEKSAEGTKPRPASSQRGSLTKSHMGVSLPMGAPA 66
|..|..|.:: ...|||..|||....:...::..|..| .|..||..|.:| ::|.|..:
Mouse 24 GAGPGRRAAR---ATAAAKTTETGGAGADDSGRARGGAVP-AAVRQRPGLPRS----AVPKGERS 80
Fly 67 AKP 69
|.|
Mouse 81 ALP 83
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG14763 | NP_001286175.1 |
DLC-like_SF |
86..186 |
CDD:425407 |
|
Dynlt2a1 | XP_036016363.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4108 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0009927 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_111885 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
5 | 4.670 |
|
Return to query results.
Submit another query.