DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and dylt-2

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_509511.1 Gene:dylt-2 / 183892 WormBaseID:WBGene00017014 Length:123 Species:Caenorhabditis elegans


Alignment Length:120 Identity:22/120 - (18%)
Similarity:50/120 - (41%) Gaps:12/120 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PTMRFMPTYRLESKNPLNKERVENIIKAVMNRHYNDEYMFHPKHSLHMAAQVSEEIKNRIKLDNY 133
            |..:|.|            :.|..:|:.::........:::...:..::..:|..|:.|:|....
 Worm    15 PGQKFRP------------KAVAGMIQEILGEKLGALTIYNVDEAELVSKDISASIRERLKGLQL 67

  Fly   134 DRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLYY 188
            .||:|::...:.|....|..:.|..:||.:.||::|......|.:.....|.:::
 Worm    68 PRYKYVIQTMIAEQCGNGATTAVQCVWDEDCDGYLTQRYVTGSIWCEVLVFAIFH 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 19/99 (19%)
dylt-2NP_509511.1 Tctex-1 23..121 CDD:281624 19/97 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160189
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4108
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6688
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.690

Return to query results.
Submit another query.