DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14763 and Dynlt2a2

DIOPT Version :9

Sequence 1:NP_001286175.1 Gene:CG14763 / 35757 FlyBaseID:FBgn0033243 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001116839.1 Gene:Dynlt2a2 / 100041639 MGIID:3809205 Length:191 Species:Mus musculus


Alignment Length:130 Identity:31/130 - (23%)
Similarity:62/130 - (47%) Gaps:18/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AAKPTMRFMPTYRLESKNPLNK-------ERVENIIK-AVMNRHYNDEYMFHPKHSLHMAAQVSE 122
            :|...::|..:||:|   ||.|       .:::.|:| ::.:..|:|:       :.|::.::::
Mouse    70 SALAKLKFANSYRME---PLKKFQAHLVETKIQQILKDSLKDVKYDDK-------APHLSLELAD 124

  Fly   123 EIKNRIKLDNYDRYRYIVLVTVGEFLMQGLYSMVNFLWDAEKDGFVTYSVERPSYFAVCTTFYLY 187
            .|...:|...|.||::|:.|...:...|.:.....::||...|.:|....|..||..:...|.||
Mouse   125 RILAAVKEFAYHRYKFIIQVLFIQKTGQAINIASRWIWDVAWDNWVEAKHETESYVVLALVFALY 189

  Fly   188  187
            Mouse   190  189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14763NP_001286175.1 DLC-like_SF 86..186 CDD:425407 22/107 (21%)
Dynlt2a2NP_001116839.1 Tctex-1 94..189 CDD:281624 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009927
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_111885
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.