DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nito and RS41

DIOPT Version :9

Sequence 1:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_200017.2 Gene:RS41 / 835279 AraportID:AT5G52040 Length:357 Species:Arabidopsis thaliana


Alignment Length:370 Identity:89/370 - (24%)
Similarity:134/370 - (36%) Gaps:105/370 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 RTLFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGNAFAFV--------------RYQNL 364
            :.:|.||.|....:.:|.|:|.|||.|:.:|:|     .|.||.::              |::..
plant     2 KPVFCGNFEYDARESDLERLFRKYGKVERVDMK-----AGFAFVYMEDERDAEDAIRALDRFEYG 61

  Fly   365 DMAHRAKIEL-------SGQYIGKFQCKIGYGKVTPATRMWIGGLGAWTSVTQ-LEREFDRFGAI 421
            ....|.::|.       :|:..|..:...|   :.|:..:::....|..:.|: |||.|:.:|.|
plant    62 RTGRRLRVEWTKNDRGGAGRSGGSRRSSSG---LRPSKTLFVINFDAQNTRTRDLERHFEPYGKI 123

  Fly   422 KKIEYQKGEPYAYIQYETVEAATAAVKEMRGFPL----------------------------GGP 458
            ..:..::.  :|:||||..|.||.|:.......|                            ..|
plant   124 VNVRIRRN--FAFIQYEAQEDATRALDATNSSKLMDKVISVEYAVKDDDSRGNGYSPERRRDRSP 186

  Fly   459 ERRLRT-----------DFAELPGATPAAPFKS-SKPPYD---ESALEYRRPEYDPYYEESAAYA 508
            :||.|:           |:..  ||:|.|..:. :.|.|.   .|...|:|....|.|:......
plant   187 DRRRRSPSPYRRERGSPDYGR--GASPVAHKRERTSPDYGRGRRSPSPYKRARLSPDYKRDDRRR 249

  Fly   509 PRGGYSPYPPRGGYRGRGGYRGRGRGMYHYHNDVHRPPHPGSLAGSSSSVPPPGGVEDEWRRPPG 573
            .|   ...|..|..|.|...:|||..         |.|.|......|.| |||.....|.|.|| 
plant   250 ER---VASPENGAVRNRSPRKGRGES---------RSPPPYEKRRESRS-PPPYEKRRESRSPP- 300

  Fly   574 ESYDRGARSSSREPGVERSRSRSPLK----RARSPGSDSDTSTRR 614
             .|::..         |||||||...    :..|||...:....|
plant   301 -PYEKRR---------ERSRSRSKSSPENGQVESPGQIMEVEAGR 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755 22/96 (23%)
RRM3_Spen 397..467 CDD:240756 23/109 (21%)
SPOC 630..789 CDD:311609
RS41NP_200017.2 RRM1_AtRSp31_like 2..73 CDD:409680 19/75 (25%)
RRM 9..289 CDD:223796 68/304 (22%)
RRM2_AtRSp31_like 97..166 CDD:409899 18/70 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.