DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nito and rbm4.2

DIOPT Version :9

Sequence 1:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_955971.1 Gene:rbm4.2 / 557528 ZFINID:ZDB-GENE-030131-3019 Length:385 Species:Danio rerio


Alignment Length:398 Identity:90/398 - (22%)
Similarity:137/398 - (34%) Gaps:138/398 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   316 LFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGNAFAFVRYQNLDMAHRA-----KIELS 375
            :|.|||..|...|:||.:|.::|:|.:.|:.:       .:.||...:...|..|     ..||.
Zfish     4 IFIGNLSPTSTADDLRSLFSEFGIVKECDVLK-------NYGFVHMDSKKEAEAAIRKLHHYELK 61

  Fly   376 GQYIGKFQCKIGYGKVTPATRMWIGGLGAWTSVTQLEREFDRFGAIKKIEYQKGEPYAYIQYETV 440
            ||.|   ..::..||...:|::.:..:.:..:..:|..:|:.:|.:.:.:..|  .||::..|.:
Zfish    62 GQAI---NVE
LSKGKPRGSTKLHVSNISSGCTNQELRAKFEEYGPVVECDIVK--DYAFVHMERM 121

  Fly   441 EAATAAV--------------------------------------------KEMR---------- 451
            :.|..|:                                            |:.|          
Zfish   122 DDAMEAISGLENTTFQGKLIKVQLSTSRLRTAPGMGDQTGCYICGEQGHWSKDCRHSQNGSYGGG 186

  Fly   452 --GFPLGGPERRLRTDFAELPGATPAAPFKSS--KPPYDESALEYRRPEYDPYYEESAAYAPRGG 512
              |:|..||.|...:.....||..|:..:.:.  .||...|    |||.|..|..|     ||..
Zfish   187 MGGYPSRGPPRGGPSYGMGGPGGHPSRGYPAGPLPPPPPMS----RRPSYGEYGAE-----PRER 242

  Fly   513 Y-----SPYPPRGGY--RGRGG-------YRGRGRGMYHYHNDVHR---PPHPGSLAGSSSS--- 557
            |     :.||.|...  |.|.|       :|.......:|.:..|.   ||.|..|:.||.|   
Zfish   243 YLTRVPTGYPERPPVYERDRFGSIDYYEKFRAHPAASSYYEDRPHAIPPPPPPPPLSSSSLSRMR 307

  Fly   558 VPPPGGVEDEWRRP----------------------------PGESYDRGARSSSREPGVERSRS 594
            :.|| .::...|||                            .|.||:|     ||...|.||.|
Zfish   308 LAPP-SLDPYERRPLAPPPPTAAAAASFARDRSPIRRVGAGAEGYSYER-----SRLSPVSRSSS 366

  Fly   595 RSPLKRAR 602
            ...|.|||
Zfish   367 AYSLPRAR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755 21/78 (27%)
RRM3_Spen 397..467 CDD:240756 16/125 (13%)
SPOC 630..789 CDD:311609
rbm4.2NP_955971.1 RRM1_2_CoAA_like 3..68 CDD:240789 21/73 (29%)
RRM_SF 78..144 CDD:302621 10/67 (15%)
ZnF_C2HC 161..177 CDD:197667 1/15 (7%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.