DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nito and Nono

DIOPT Version :9

Sequence 1:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster
Sequence 2:XP_030107241.1 Gene:Nono / 53610 MGIID:1855692 Length:482 Species:Mus musculus


Alignment Length:211 Identity:52/211 - (24%)
Similarity:90/211 - (42%) Gaps:28/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 HPPRGPPLHRGGHPHHLHGHAPPH----QYAPMRPLAPRPHAPYEKPESKKDKFPNYLHHV-QPE 307
            |.||         .||.|.|...|    |....:|..|.| |..::..|:.:.....|.:. :|.
Mouse    14 HTPR---------KHHQHHHQQHHQQQQQQQQQQPPPPIP-ANGQQASSQNEGLTIDLKNFRKPG 68

  Fly   308 DDPLSTRT-LFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGNAFAFVRYQNLDMAHRAK 371
            :...:.|: ||.|||...|.::|:|::|.|||...::.|.:     ...|.|:|.:...:|..||
Mouse    69 EKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHK-----DKGFGFIRLETRTLAEIAK 128

  Fly   372 IELSGQYIGKFQCKIGYGKVTPATRMWIGGLGAWTSVTQLEREFDRFGAIKK---IEYQKGEP-- 431
            :||....:...|.::.:  ...:..:.:..|..:.|...||..|..||.:::   |...:|.|  
Mouse   129 VELDNMPLRGKQLRVRF--ACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSG 191

  Fly   432 YAYIQYETVEAATAAV 447
            ...:::....||..|:
Mouse   192 KGIVEFSGKPAARKAL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755 23/78 (29%)
RRM3_Spen 397..467 CDD:240756 13/56 (23%)
SPOC 630..789 CDD:311609
NonoXP_030107241.1 RRM1_p54nrb 75..145 CDD:241032 23/74 (31%)
RRM_SF 151..230 CDD:388407 13/57 (23%)
NOPS_p54nrb_PSF_PSPC1 221..313 CDD:240581
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.