DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nito and NONO

DIOPT Version :9

Sequence 1:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_001138880.1 Gene:NONO / 4841 HGNCID:7871 Length:471 Species:Homo sapiens


Alignment Length:208 Identity:51/208 - (24%)
Similarity:89/208 - (42%) Gaps:24/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 HPPRGPPLHRGGHPHHLHGHAPP-HQYAPMRPLAPRPHAPYEKPESKKDKFPNYLHHV-QPEDDP 310
            |.||         .||.|.|... ||....:|..|...|..::..|:.:.....|.:. :|.:..
Human    14 HTPR---------KHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLKNFRKPGEKT 69

  Fly   311 LSTRT-LFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGNAFAFVRYQNLDMAHRAKIEL 374
            .:.|: ||.|||...|.::|:|::|.|||...::.|.:     ...|.|:|.:...:|..||:||
Human    70 FTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHK-----DKGFGFIRLETRTLAEIAKVEL 129

  Fly   375 SGQYIGKFQCKIGYGKVTPATRMWIGGLGAWTSVTQLEREFDRFGAIKK---IEYQKGEP--YAY 434
            ....:...|.::.:  ...:..:.:..|..:.|...||..|..||.:::   |...:|.|  ...
Human   130 DNMPLRGKQLRVRF--ACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVIVDDRGRPSGKGI 192

  Fly   435 IQYETVEAATAAV 447
            :::....||..|:
Human   193 VEFSGKPAARKAL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755 23/78 (29%)
RRM3_Spen 397..467 CDD:240756 13/56 (23%)
SPOC 630..789 CDD:311609
NONONP_001138880.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..51 12/45 (27%)
DBHS 54..373 38/159 (24%)
RRM1_p54nrb 73..143 CDD:410001 23/74 (31%)
RRM_SF 149..228 CDD:418427 13/57 (23%)
NOPS_p54nrb_PSF_PSPC1 219..311 CDD:240581
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 443..471
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154205
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.