DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nito and rbm14b

DIOPT Version :9

Sequence 1:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster
Sequence 2:XP_021333123.1 Gene:rbm14b / 402858 ZFINID:ZDB-GENE-040426-2455 Length:560 Species:Danio rerio


Alignment Length:256 Identity:64/256 - (25%)
Similarity:99/256 - (38%) Gaps:58/256 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 TRTLFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGNAFAFVRYQNLDMAHRAKIELSG- 376
            |..||.|||.:....:||..||..||.|....:.|       .||||..|....|.||..||:| 
Zfish     6 TVKLFVGNLALDTTQEELSAIFESYGQVVSCSVLR-------QFAFVHLQGEGAAERAIRELNGR 63

  Fly   377 QYIGK-FQCKIGYGKVTPATRMWIGGLGAWTSVTQLEREFDRFGAIKKIEYQKGEPYAYIQYETV 440
            ::.|: ...:...|:...:|::::|.|.:..:...|:..|..||  |.:|..|.:.||::..|..
Zfish    64 EFKGRNLVVEESRGRPLHSTKVFVGNLSSMCTTEDLQELFQTFG--KVLECDKVKGYAFVHMENK 126

  Fly   441 EAATAAVKEMRGFPLGG-----------PERRLRTDFAELP-----------GATPAAPFKSSKP 483
            |.|..|::.:.|....|           |.:  :|...::|           |..||.  |.:..
Zfish   127 EDALQAIEALHGTSFKGRPLSVELSKVQPSK--QTPTGKIPCVSCGKQGHYAGECPAG--KPTLE 187

  Fly   484 PYDESA--------------LEYRRPEYDPYYEESA---AYAPRGGYSPYPPRGGYRGRGG 527
            .|...|              |:.::..::..|..|.   .||...|.:    ..|.|..||
Zfish   188 QYQSQAAVLAAAAAAAAGLPLQVQQSVHNSVYNTSTFDPTYAALTGLT----AAGARAEGG 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755 26/78 (33%)
RRM3_Spen 397..467 CDD:240756 19/80 (24%)
SPOC 630..789 CDD:311609
rbm14bXP_021333123.1 RRM1_CoAA 7..75 CDD:241052 25/74 (34%)
RRM1_2_CoAA_like 84..149 CDD:240789 17/66 (26%)
AIR1 <150..>187 CDD:331526 7/40 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.