DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nito and nono

DIOPT Version :9

Sequence 1:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_963873.1 Gene:nono / 321994 ZFINID:ZDB-GENE-030131-713 Length:441 Species:Danio rerio


Alignment Length:295 Identity:61/295 - (20%)
Similarity:98/295 - (33%) Gaps:80/295 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 RGPPLHRGGHPHHLHGHAPPHQYAPMRPLAPRPHAPYE-KP----------ESKKDKFPN----- 299
            |||...:       ..|.|..|       .|.|....: ||          ::.:...||     
Zfish     5 RGPRSEQ-------QNHGPQRQ-------QPNPQQEQQRKPTGADSNGQHTDAGEQSSPNAGFTI 55

  Fly   300 -YLHHVQPEDDPLSTRT-LFAGNLEVTIADDELRRIFGKYGVVDDIDIKRPPPGTGNAFAFVRYQ 362
             ..:..:|.:...:.|: ||.|||.....::::.::|.|||...:|.|.:     ...|.|:|.:
Zfish    56 DLQNFKKPGEKTYTQRSRLFVGNLPAGTTEEDVEKLFSKYGKASEIFINK-----DRGFGFIRLE 115

  Fly   363 NLDMAHRAKIELSGQYIGKFQCKIGYGKVTPATRMWIGGLGAWTSVTQLEREFDRFGAIKKIEYQ 427
            ...:|..||.||........|.::.:  .|....:.:..|..:.|...||..|..||.|::    
Zfish   116 TKTLADIAKAELDDTIFRGRQIRVRF--ATHGAALTVKNLPQFVSNELLEEAFSMFGPIER---- 174

  Fly   428 KGEPYAYIQYETVEAATAAVKEMRGFPLGGPERRLRTDFAELPGATPAA-------------PFK 479
                            ...:.:.||.|.|    :...:||..|.|..|.             |..
Zfish   175 ----------------AIVIVDDRGRPTG----KGIVEFANKPSARKALDRCGDGAFLLTAFPRP 219

  Fly   480 SSKPPY----DESALEYRRPEYDPYYEESAAYAPR 510
            .:..|.    :|..|..|....:|.|.:.....||
Zfish   220 VTIEPMEQLDEEEGLPERLINKNPVYHKEREQPPR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755 21/78 (27%)
RRM3_Spen 397..467 CDD:240756 12/69 (17%)
SPOC 630..789 CDD:311609
nonoNP_963873.1 RRM_SF 71..141 CDD:302621 21/74 (28%)
RRM2_p54nrb 147..226 CDD:241035 19/102 (19%)
NOPS_p54nrb 217..310 CDD:240582 9/38 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589408
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.