DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nito and rsp-6

DIOPT Version :9

Sequence 1:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_741446.1 Gene:rsp-6 / 177566 WormBaseID:WBGene00004703 Length:179 Species:Caenorhabditis elegans


Alignment Length:231 Identity:64/231 - (27%)
Similarity:91/231 - (39%) Gaps:61/231 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   396 RMWIGGLGAWTSVTQLEREFDRFGAIKKIEYQKGEP-YAYIQYETVEAATAAVKEMRGFPLGGPE 459
            ::::|||.:..:..:||..|||||.|:|:...:..| :|:::|:.|..|..||:.:.|..:.|..
 Worm     4 KVYVGGLPSDATSQELEEIFDRFGRIRKVWVARRPPGFAFVEYDDVRDAEDAVRALDGSRICGVR 68

  Fly   460 RRLRTDFAELPGATPAAPFKSSKPPYDESALEYRRPEYDPYYEESAAYAPRGGYSPYPPRGGYRG 524
            .|:.....:..|                                                ||.||
 Worm    69 ARVELSTGQRRG------------------------------------------------GGGRG 85

  Fly   525 RGGYRGRGRGMYHYHNDVHRPPHPGSLAGSSSSVPPPGGVEDEWRRPPGESYDRG---ARSSSRE 586
             ||:.|||.|      ...|.|:.|. .|.|.|.....|.:....|....|.||.   :|..|||
 Worm    86 -GGFGGRGGG------GRDRSPYRGD-RGRSRSRSRDRGRDRSRDRSRDRSRDRSRDRSRERSRE 142

  Fly   587 PGVERSRSRSPLKRARSPGSDSDTSTRRNDALASAS 622
            ....|||||||.:|.|| .|.|.:.:|......|||
 Worm   143 RERTRSRSRSPQERDRS-HSKSRSRSRSRSRSRSAS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755
RRM3_Spen 397..467 CDD:240756 22/70 (31%)
SPOC 630..789 CDD:311609
rsp-6NP_741446.1 RRM <2..>75 CDD:223796 22/70 (31%)
RRM_SRSF3_like 4..75 CDD:240819 22/70 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.