DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nito and RBM14-RBM4

DIOPT Version :9

Sequence 1:NP_001286174.1 Gene:nito / 35756 FlyBaseID:FBgn0027548 Length:793 Species:Drosophila melanogaster
Sequence 2:NP_001185774.1 Gene:RBM14-RBM4 / 100526737 HGNCID:38840 Length:339 Species:Homo sapiens


Alignment Length:418 Identity:76/418 - (18%)
Similarity:117/418 - (27%) Gaps:200/418 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LHGHAPPHQYAPMRPLAPRPHAPYEKPESKKDKFPNYLHHVQPEDDPLSTRTLFAGNLEVTIADD 328
            |||    |:..|.|.|......|                      .||:|..:|.||:.......
Human    55 LHG----HELRPGRALVVEMSRP----------------------RPLNTWKIFVGNVSAACTSQ 93

  Fly   329 ELRRIFGKYGVVDDIDIKRPPPGTGNAFAFVRYQNLDMAHRAKIELS----------GQYIGKFQ 383
            |||.:|.:.|.|.:.|:.:                   ..|..::||          |...|.::
Human    94 ELRSLFERRGRVIECDVVK-------------------GKRMHVQLSTSRLRTAPGMGDQSGCYR 139

  Fly   384 CKIGYGKVTPATRMWIGGLGAWTSVTQLEREFDRFGAIKKIEYQKGEPYAYIQ------------ 436
            |               |..|.|:.    |...||.|.:..:..|..|.|..::            
Human   140 C---------------GKEGHWSK----ECPIDRSGRVADLTEQYNEQYGAVRTPYTMSYGDSLY 185

  Fly   437 --------------------YETVEAATAAVKEMRGFPLGGPERRLRTDFAELPGATPAAPFKSS 481
                                ||.|.||.|:|                .::||        ...|.
Human   186 YNNAYGALDAYYKRCRAARSYEAVAAAAASV----------------YNYAE--------QTLSQ 226

  Fly   482 KPPYDESALEYRRPEYDPYYEESAAYAPRGGYSPYPPRGGYRGRGGYRGRGRGMYHYHNDVHRPP 546
            .|....:|:              |::.......||                        |.|..|
Human   227 LPQVQNTAM--------------ASHLTSTSLDPY------------------------DRHLLP 253

  Fly   547 HPGSLAGSSSSVPPPGGVEDEWRRPPGESYDRGARSSSREPGVERSRSRSPLKRARSP------- 604
            ..|:.|.::::......|.              |.|:|     ...|.||||:||.:|       
Human   254 TSGAAATAAAAAAAAAAVT--------------AASTS-----YYGRDRSPLRRATAPVPTVGEG 299

  Fly   605 ---GSDSDTSTRRNDALASASTVPDVAR 629
               |.:|:.|   ..:.|:.:::.|:||
Human   300 YGYGHESELS---QASAAARNSLYDMAR 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nitoNP_001286174.1 RRM <56..>223 CDD:223796
RRM1_Spen 98..175 CDD:240754
RRM2_Spen 312..390 CDD:240755 17/87 (20%)
RRM3_Spen 397..467 CDD:240756 17/101 (17%)
SPOC 630..789 CDD:311609 76/418 (18%)
RBM14-RBM4NP_001185774.1 RRM1_CoAA 1..71 CDD:241052 7/19 (37%)
RRM_SF 79..>113 CDD:302621 10/52 (19%)
ZnF_C2HC 136..151 CDD:197667 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.