DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and AGBL4

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_011540610.1 Gene:AGBL4 / 84871 HGNCID:25892 Length:531 Species:Homo sapiens


Alignment Length:380 Identity:77/380 - (20%)
Similarity:123/380 - (32%) Gaps:138/380 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 ADIADLLKTYKVKHRVL--TYNFQEKIDRNLAEVQPESIDASQLDWQH----------------- 152
            :.:.:::.|::|..||:  ..||.:........:.|.....|:..||.                 
Human    93 SQVREIVDTFRVVLRVIFNIVNFSKTKSLYRDGMAPMVKSTSRPKWQRLPPKNVYYYRCPDHRKN 157

  Fly   153 --------FFHLKTIYE--------------WLDKMVEKYPNRVTVLDMGSSTQGNAIKGVKLTS 195
                    |...:.||:              :||.:.::..:......:|.|.|...:..:.:||
Human   158 YVMSFAFCFDREEDIYQFAYCYPYTYTRFQHYLDSLQKRNMDYFFREQLGQSVQQRKLDLLTITS 222

  Fly   196 ------NANNKAIFIESGIHARE-----------------------------WISPAAATYIINQ 225
                  .|..|.:||...:|..|                             |:||.     |..
Human   223 PDNLREGAEQKVVFITGRVHPGETPSSFVCQGIPPGHWAALSSSFQNSPGIHWMSPG-----IID 282

  Fly   226 LLTSQDPKVQQLAQDYNWIIFPCVNPDG-YKYTFEHDRMWRKNRQLFGTCRGVDLNRNYPDHWNS 289
            .|.||.|....|.:...:.|.|.:|||| |...:....|            |.||||    ||..
Human   283 FLVSQHPIACVLREYLVFKIAPMLNPDGVYLGNYRCSLM------------GFDLNR----HWLD 331

  Fly   290 TGSSSDPTRYDFAGPSAGSELETKRLIDFIRANAGKEQIKTYIALHSYSQMLM-FPYGYTKERVS 353
            ......||.:.           .|:|| ....|..|..::.||.:|::|.|:. |.||      :
Human   332 PSPWVHPTLHG-----------VKQLI-VQMYNDPKTSLEFYIDIHAHSTMMNGFMYG------N 378

  Fly   354 NYDDLQEFGKKA---------------------SAAIKAENGRDYVSGSLFETIY 387
            .::|.:.|.::|                     ..|:||..||.::.|.|..|.|
Human   379 IFEDEERFQRQAIFPKLLCQNAEDFSYSSTSFNRDAVKAGTGRRFLGGLLDHTSY 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 77/380 (20%)
Propep_M14 63..133 CDD:280416 6/27 (22%)
M14_CP_A-B_like 153..446 CDD:199844 67/307 (22%)
AGBL4XP_011540610.1 M14_AGBL4_like 190..475 CDD:133118 64/283 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.