DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and AGBL2

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_079059.2 Gene:AGBL2 / 79841 HGNCID:26296 Length:902 Species:Homo sapiens


Alignment Length:438 Identity:89/438 - (20%)
Similarity:138/438 - (31%) Gaps:156/438 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 GNPPDQARYDNYRIYNVEFENQEQIELFQKLEEQSDSLTFIGHAREVGQKLSILVAAHRVADIAD 111
            ||.....|.|.|     |:|...:.:|:.....|    .|....:...:.     |.:|.. |.:
Human   275 GNLQKAVRVDTY-----EYELTLRTDLYTNKHTQ----WFYFRVQNTRKD-----ATYRFT-IVN 324

  Fly   112 LLK---TYKVKHRVLTYNFQEKIDRNLA------EVQ--PESIDASQLDWQHFFHLK-TIYEWLD 164
            |||   .|.|..:.|.|:..:...||:.      |::  ..:.|..|   |.|:.|. ||....|
Human   325 LLKPKSLYTVGMKPLLYSQLDANTRNIGWRREGNEIKYYKNNTDDGQ---QPFYCLTWTIQFPYD 386

  Fly   165 K----MVEKYPNRVTVLD--------------------MGSSTQGNAIKGVKLTS-------NAN 198
            :    ....||...|.|.                    :..|..||.:..:.:|:       .|.
Human   387 QDTCFFAHFYPYTYTDLQCYLLSVANNPIQSQFCKLQTLCRSLAGNTVYLLTITNPSQTPQEAAA 451

  Fly   199 NKAIFIESGIHARE----WISPAAATYIINQLLTSQDPKVQQLAQDYNWIIFPCVNPDGYKYTFE 259
            .||:.:.:.:|..|    |:......:|:     |..|..|.|...:.:.:.|.:||||.     
Human   452 KKAVVLSARVHPGESNGSWVMKGFLDFIL-----SNSPDAQLLRDIFVFKVLPMLNPDGV----- 506

  Fly   260 HDRMWRKNRQLFGTCR----GVDLNRNY--------PDHWNSTGSSSDPTRYDFAGPSAGSELET 312
                      :.|..|    |.||||:|        |..|.:...                   .
Human   507 ----------IVGNYRCSLAGRDLNRHYKTILKESFPCIWYTRNM-------------------I 542

  Fly   313 KRLIDFIRANAGKEQIKTYIALHSYSQM-LMFPYG--------YTKERV------SNYDDLQEFG 362
            |||::       :.::..|...|.:|:. .:|.||        :..|||      .|..|...|.
Human   543 KRLLE-------EREVLLYCDFHGHSRKNNIFLYGCNNNNRKYWLHERVFPLMLCKNAPDKFSFH 600

  Fly   363 KKASAAIKAENGRDYVSGSLFETIYPSSGGSMDWAHSEAGIPIAYTFE 410
            .......|.:.|               :|..:.|   ..||..:||.|
Human   601 SCNFKVQKCKEG---------------TGRVVMW---RMGILNSYTME 630

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 87/435 (20%)
Propep_M14 63..133 CDD:280416 15/72 (21%)
M14_CP_A-B_like 153..446 CDD:199844 63/321 (20%)
AGBL2NP_079059.2 GVQW 105..>120 CDD:290611
M14_AGBL2-3_like 407..666 CDD:133117 54/288 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 746..770
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 796..879
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.