DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and Agtpbp1

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001364026.1 Gene:Agtpbp1 / 67269 MGIID:2159437 Length:1218 Species:Mus musculus


Alignment Length:229 Identity:53/229 - (23%)
Similarity:82/229 - (35%) Gaps:59/229 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 IFIESGIHARE----WISPAAATYIINQLLTSQDPKVQQLAQDYNWIIFPCVNPDGYKYTFEHDR 262
            ||:.:.:|..|    |:......|     |.|..|..|.|.:.|.:.|.|.:||||.        
Mouse   905 IFLSARVHPGETNASWVMKGTLEY-----LMSNSPTAQSLRESYIFKIVPMLNPDGV-------- 956

  Fly   263 MWRKNRQLFGTCR----GVDLNRNYPDHWNSTGSSSDPTRYDFAGPSAGSELETKRLIDFIRANA 323
                   :.|..|    |.||||    .|.|......||.|           ..|.|:.::.  |
Mouse   957 -------INGNHRCSLSGEDLNR----QWQSPNPELHPTIY-----------HAKGLLQYLA--A 997

  Fly   324 GKEQIKTYIALHSYSQML-MFPYG--------YTKERVSNYDDLQEFGKKASAAIKAENGRDYVS 379
            .|.....|...|.:|:.. :|.||        :|.:..::.|.:::.|.:....|.:.....:..
Mouse   998 VKRLPLVYCDYHGHSRKKNVFMYGCSIKETVWHTHDNSASCDIVEDMGYRTLPKILSHIAPAFCM 1062

  Fly   380 GS---LFETIYPSSGGSMDWAHSEAGIPIAYTFE 410
            .|   :.|....|:...:.|  .|.|:..:||.|
Mouse  1063 SSCSFVVEKSKESTARVVVW--REIGVQRSYTME 1094

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 53/229 (23%)
Propep_M14 63..133 CDD:280416
M14_CP_A-B_like 153..446 CDD:199844 53/229 (23%)
Agtpbp1NP_001364026.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..512
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..617
Pepdidase_M14_N 704..838 CDD:407865
M14_Nna1 861..1131 CDD:349477 53/229 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1193..1218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.