DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and agbl2

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_017209580.1 Gene:agbl2 / 568152 ZFINID:ZDB-GENE-070719-6 Length:1025 Species:Danio rerio


Alignment Length:257 Identity:53/257 - (20%)
Similarity:94/257 - (36%) Gaps:81/257 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 STQGNAIKGVKLTSNANN-------KAIFIESGIHARE----WISPAAATYIINQLLTSQDPKVQ 235
            |..|||:..:.:|:.:::       :|:.:.:.:|..|    |:......::::.|     |...
Zfish   366 SLAGNAVYVLTITAPSSSLAERKAKRAVVVTARVHPGETNGSWMMQGFLEFLLSDL-----PDAH 425

  Fly   236 QLAQDYNWIIFPCVNPDGYKYTFEHDRMWRKNRQLFGTCR----GVDLNRNY--------PDHWN 288
            .|.:.:.:.:.|.:||||.               :.|..|    |.||||||        |..|.
Zfish   426 LLRETFIFKVIPMLNPDGV---------------VVGNYRCSLAGRDLNRNYRSMLRDSFPCIWY 475

  Fly   289 STGSSSDPTRYDFAGPSAGSELETKRLIDFIRANAGKEQIKTYIALHSYSQM-LMFPYGYTKERV 352
            :...                   .|||:       .:.::..|...|.:|:. .:|.|| ..||.
Zfish   476 TRNM-------------------VKRLL-------AEREVVVYCDFHGHSRKNNVFMYG-CNERK 513

  Fly   353 SNYDDLQEFGKKASAAIKAENGRDYVSGSLFET----IYPSSGGSMDWAHSEAGIPIAYTFE 410
            .....|||   :....:.::|.:|..|   |.:    ::.|..|:........||..:||.|
Zfish   514 DASQCLQE---RVFPLMMSKNAKDKFS---FRSCKFKMHKSKEGTGRIVMWRLGIRNSYTME 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 53/257 (21%)
Propep_M14 63..133 CDD:280416
M14_CP_A-B_like 153..446 CDD:199844 53/257 (21%)
agbl2XP_017209580.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2866
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.