DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and cpb1

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_031758320.1 Gene:cpb1 / 496994 XenbaseID:XB-GENE-853710 Length:414 Species:Xenopus tropicalis


Alignment Length:435 Identity:131/435 - (30%)
Similarity:217/435 - (49%) Gaps:40/435 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 WLVILCVAMAASGTNLDSGICPVAGDSGCRGNPPDQARYDNYRIYNVEFENQEQIELFQKLEEQS 81
            |.::|.|::||...                    :...:...:::.|..:|.|.:||.:.: .|:
 Frog     2 WALLLLVSLAAVSA--------------------EPRNFHGEKVFRVIPQNAEHVELIKSM-AQT 45

  Fly    82 DSLTF----IGHAREVGQKLSILVAAHRVADIADLLKTYKVKHRVLTYNFQEKIDRNLAEVQPES 142
            :.|.|    .....|.|::.......|...::..||:...:.:.:|..:.|:.:::     |.:|
 Frog    46 EGLDFWLPDSAQLVEQGKRADFHADGHVSYEVQALLQQSGMPYEILINDLQDALEK-----QRDS 105

  Fly   143 IDASQLDWQHFFHLKTIYEWLDKMVEKYPNRVTVLDMGSSTQGNAIKGVKL-TSNANNKAIFIES 206
            ...:...::.:..|.||..|...:..:.|..|:...:|:|.||..|..:|: .|.||.||:||:.
 Frog   106 NIRAVHSYEKYNDLDTINAWSANIAAQNPGLVSRSSIGTSYQGRPIYLLKVGKSGANKKAVFIDC 170

  Fly   207 GIHAREWISPAAATYIINQLLTSQ--DPKVQQLAQDYNWIIFPCVNPDGYKYTFEHDRMWRKNRQ 269
            |.|||||||||...:.:.:.:::.  :.:...|..:.:..:.|.:|.|||.||:..:|||||.|.
 Frog   171 GFHAREWISPAFCQWFVKEAVSAYGVESEFTSLLDNLDIYVLPVLNVDGYVYTWTTNRMWRKTRS 235

  Fly   270 L--FGTCRGVDLNRNYPDHWNSTGSSSDPTRYDFAGPSAGSELETKRLIDFIRANAGKEQIKTYI 332
            .  ..||.|.|.|||:...|.:.|:|:......:.|.:..||.|||.|.:|||||.  ..||.|:
 Frog   236 ANPNSTCIGTDPNRNFNAGWCTAGASTRACDETYCGSAPESEPETKALANFIRANI--PAIKGYL 298

  Fly   333 ALHSYSQMLMFPYGYTKERVSNYDDLQEFGKKASAAIKAENGRDYVSGSLFETIYPSSGGSMDWA 397
            .:|||||||:|||.|:.....::::|....:.|..::.:.....|..|....|||.::|||.|||
 Frog   299 TIHSYSQMLLFPYSYSYAVAKDHNELNAVAQGAVNSLTSLYKTKYTYGPGGSTIYLAAGGSDDWA 363

  Fly   398 HSEAGIPIAYTFELRGPPDSQDLFILPAVEIQPTASEAFTAIRAI 442
            : :||:..:||||||  ...:..|.||..:|:||..|...|::.|
 Frog   364 Y-DAGVKFSYTFELR--DTGRYGFALPESQIKPTCEETMLAVKYI 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 123/391 (31%)
Propep_M14 63..133 CDD:280416 15/73 (21%)
M14_CP_A-B_like 153..446 CDD:199844 109/295 (37%)
cpb1XP_031758320.1 Propep_M14 31..102 CDD:396700 14/76 (18%)
M14_CPB 111..410 CDD:349443 109/300 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X86
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.