DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2915 and CG8564

DIOPT Version :9

Sequence 1:NP_610338.1 Gene:CG2915 / 35754 FlyBaseID:FBgn0033241 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001261514.1 Gene:CG8564 / 38825 FlyBaseID:FBgn0035776 Length:520 Species:Drosophila melanogaster


Alignment Length:398 Identity:110/398 - (27%)
Similarity:182/398 - (45%) Gaps:84/398 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 GQKLSILVAAHRVADIADLLKTYKVKHRVLTYNFQEKID-----RNLAEVQPESIDASQLDWQHF 153
            |.:|::||......:|    |....|.|       .:.|     |.|...:|:.:. :.||:   
  Fly     8 GTRLALLVVERLHLNI----KCQTAKDR-------SRTDATTALRRLVIPRPDILH-TYLDY--- 57

  Fly   154 FHLKTIYEWLDKMVEKYPNRVTVLDMGSSTQGNAIKGVKLT-SNANN------------------ 199
               |.:.::|..:.::|.:.|.|..:|.:.:...|:.:::. .|:.|                  
  Fly    58 ---KQVNQYLQYLAQRYAHFVHVHILGHTHEKREIRALEINWMNSENVELSPQMREHSPRLFDIG 119

  Fly   200 -----------------KAIFIESGIHAREWISPAAATYIINQLLTSQDPKVQQLAQDYNWIIFP 247
                             |.:|||:|.|||||||.:.|...|.| ||.:..:..::.:...:||.|
  Fly   120 PNGRFTVPVIHVGEHCRKTVFIEAGTHAREWISVSTALNCIYQ-LTERYTRNIEVLRKLRFIIVP 183

  Fly   248 CVNPDGYKYTFEHDRMWRKNRQLFGTCR--GVDLNRNYPDHWNSTGSSSDPTRYDFAGPSAGSEL 310
            .||||||:|:...:..|||||:...:.:  |.|.||||...|||  ..|...|..:.|.|..||.
  Fly   184 LVNPDGYEYSRTKNPKWRKNRRPHKSAKFVGTDCNRNYDIFWNS--GPSKINRNTYKGESPFSEP 246

  Fly   311 ETKR---LIDFIRANAGKEQIKTYIALHSYSQMLMFPYGYTKERVSNYDDLQEFGKKASAAIKAE 372
            ||:.   ::|.:.:|     :..:::||||.|.:|:|:||.::....:.:|........:|||:.
  Fly   247 ETRAMRCILDRMSSN-----LLFFLSLHSYGQSIMYPWGYCRDNPIYWRELSSLANSGKSAIKSY 306

  Fly   373 NGRDYVSGSLF----ETIYPSSGGSMDWAHSEAGIPIAYTFELRGPPDSQDLFILPAVE-IQPTA 432
            |||:|.:||:.    .||   :|..:|:.:....:|:|...||    .|::|...|.|| |....
  Fly   307 NGREYRTGSISCLTKRTI---AGSVVDYVYGVLKVPMALVMEL----PSRELGFQPPVEMISQIG 364

  Fly   433 SEAFTAIR 440
            .|::..||
  Fly   365 HESWYGIR 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2915NP_610338.1 MpaA 50..433 CDD:225421 107/389 (28%)
Propep_M14 63..133 CDD:280416 9/43 (21%)
M14_CP_A-B_like 153..446 CDD:199844 96/334 (29%)
CG8564NP_001261514.1 M14_CP_A-B_like 54..377 CDD:199844 98/340 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D208397at33208
OrthoFinder 1 1.000 - - FOG0000056
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11705
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.